KEGG   Homo sapiens (human): 1901
Entry
1901              CDS       T01001                                 

Gene name
S1PR1, CD363, CHEDG1, D1S3362, ECGF1, EDG-1, EDG1, S1P1
Definition
(RefSeq) sphingosine-1-phosphate receptor 1
  KO
K04288  sphingosine 1-phosphate receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Cenerimod: D11283
Etrasimod (DG02444): D10930
Fingolimod (DG00741): D04187<JP/US> D10001
Ozanimod (DG02827): D10967<US> D10968
Ponesimod: D11215
Siponimod (DG03018): D11072<JP/US> D11460
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    1901 (S1PR1)
   04071 Sphingolipid signaling pathway
    1901 (S1PR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1901 (S1PR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1901 (S1PR1)
   04090 CD molecules [BR:hsa04090]
    1901 (S1PR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    1901 (S1PR1)
CD molecules [BR:hsa04090]
 Proteins
  1901 (S1PR1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 JTB
Other DBs
NCBI-GeneID: 1901
NCBI-ProteinID: NP_001307659
OMIM: 601974
HGNC: 3165
Ensembl: ENSG00000170989
Vega: OTTHUMG00000010835
Pharos: P21453(Tclin)
UniProt: P21453
LinkDB
Position
1p21.2
AA seq 382 aa
MGPTSVPLVKAHRSSVSDYVNYDIIVRHYNYTGKLNISADKENSIKLTSVVFILICCFII
LENIFVLLTIWKTKKFHRPMYYFIGNLALSDLLAGVAYTANLLLSGATTYKLTPAQWFLR
EGSMFVALSASVFSLLAIAIERYITMLKMKLHNGSNNFRLFLLISACWVISLILGGLPIM
GWNCISALSSCSTVLPLYHKHYILFCTTVFTLLLLSIVILYCRIYSLVRTRSRRLTFRKN
ISKASRSSEKSLALLKTVIIVLSVFIACWAPLFILLLLDVGCKVKTCDILFRAEYFLVLA
VLNSGTNPIIYTLTNKEMRRAFIRIMSCCKCPSGDSAGKFKRPIIAGMEFSRSKSDNSSH
PQKDEGDNPETIMSSGNVNSSS
NT seq 1149 nt   +upstreamnt  +downstreamnt
atggggcccaccagcgtcccgctggtcaaggcccaccgcagctcggtctctgactacgtc
aactatgatatcatcgtccggcattacaactacacgggaaagctgaatatcagcgcggac
aaggagaacagcattaaactgacctcggtggtgttcattctcatctgctgctttatcatc
ctggagaacatctttgtcttgctgaccatttggaaaaccaagaaattccaccgacccatg
tactattttattggcaatctggccctctcagacctgttggcaggagtagcctacacagct
aacctgctcttgtctggggccaccacctacaagctcactcccgcccagtggtttctgcgg
gaagggagtatgtttgtggccctgtcagcctccgtgttcagtctcctcgccatcgccatt
gagcgctatatcacaatgctgaaaatgaaactccacaacgggagcaataacttccgcctc
ttcctgctaatcagcgcctgctgggtcatctccctcatcctgggtggcctgcctatcatg
ggctggaactgcatcagtgcgctgtccagctgctccaccgtgctgccgctctaccacaag
cactatatcctcttctgcaccacggtcttcactctgcttctgctctccatcgtcattctg
tactgcagaatctactccttggtcaggactcggagccgccgcctgacgttccgcaagaac
atttccaaggccagccgcagctctgagaagtcgctggcgctgctcaagaccgtaattatc
gtcctgagcgtcttcatcgcctgctgggcaccgctcttcatcctgctcctgctggatgtg
ggctgcaaggtgaagacctgtgacatcctcttcagagcggagtacttcctggtgttagct
gtgctcaactccggcaccaaccccatcatttacactctgaccaacaaggagatgcgtcgg
gccttcatccggatcatgtcctgctgcaagtgcccgagcggagactctgctggcaaattc
aagcgacccatcatcgccggcatggaattcagccgcagcaaatcggacaattcctcccac
ccccagaaagacgaaggggacaacccagagaccattatgtcttctggaaacgtcaactct
tcttcctag

KEGG   Homo sapiens (human): 1903
Entry
1903              CDS       T01001                                 

Gene name
S1PR3, EDG-3, EDG3, LPB3, S1P3
Definition
(RefSeq) sphingosine-1-phosphate receptor 3
  KO
K04290  sphingosine 1-phosphate receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967<US> D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    1903 (S1PR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1903 (S1PR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1903 (S1PR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    1903 (S1PR3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Tetraspanin 7tm_4 YoqO
Other DBs
NCBI-GeneID: 1903
NCBI-ProteinID: NP_005217
OMIM: 601965
HGNC: 3167
Ensembl: ENSG00000213694
Vega: OTTHUMG00000020173
Pharos: Q99500(Tclin)
UniProt: Q99500
LinkDB
Position
9q22.1
AA seq 378 aa
MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggcaactgccctcccgccgcgtctccagccggtgcgggggaacgagaccctgcgggag
cattaccagtacgtggggaagttggcgggcaggctgaaggaggcctccgagggcagcacg
ctcaccaccgtgctcttcttggtcatctgcagcttcatcgtcttggagaacctgatggtt
ttgattgccatctggaaaaacaataaatttcacaaccgcatgtactttttcattggcaac
ctggctctctgcgacctgctggccggcatcgcttacaaggtcaacattctgatgtctggc
aagaagacgttcagcctgtctcccacggtctggttcctcagggagggcagtatgttcgtg
gcccttggggcgtccacctgcagcttactggccatcgccatcgagcggcacttgacaatg
atcaaaatgaggccttacgacgccaacaagaggcaccgcgtcttcctcctgatcgggatg
tgctggctcattgccttcacgctgggcgccctgcccattctgggctggaactgcctgcac
aatctccctgactgctctaccatcctgcccctctactccaagaagtacattgccttctgc
atcagcatcttcacggccatcctggtgaccatcgtgatcctctacgcacgcatctacttc
ctggtgaagtccagcagccgtaaggtggccaaccacaacaactcggagcggtccatggca
ctgctgcggaccgtggtgattgtggtgagcgtgttcatcgcctgctggtccccactcttc
atcctcttcctcattgatgtggcctgcagggtgcaggcgtgccccatcctcttcaaggct
cagtggttcatcgtgttggctgtgctcaactccgccatgaacccggtcatctacacgctg
gccagcaaggagatgcggcgggccttcttccgtctggtctgcaactgcctggtcagggga
cggggggcccgcgcctcacccatccagcctgcgctcgacccaagcagaagtaaatcaagc
agcagcaacaatagcagccactctccgaaggtcaaggaagacctgccccacacagccccc
tcatcctgcatcatggacaagaacgcagcacttcagaatgggatcttctgcaactga

KEGG   Homo sapiens (human): 53637
Entry
53637             CDS       T01001                                 

Gene name
S1PR5, EDG8, Edg-8, S1P5, SPPR-1, SPPR-2
Definition
(RefSeq) sphingosine-1-phosphate receptor 5
  KO
K04295  sphingosine 1-phosphate receptor 5
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967<US> D10968
Siponimod (DG03018): D11072<JP/US> D11460
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    53637 (S1PR5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    53637 (S1PR5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    53637 (S1PR5)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    53637 (S1PR5)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 53637
NCBI-ProteinID: NP_001159687
OMIM: 605146
HGNC: 14299
Ensembl: ENSG00000180739
Vega: OTTHUMG00000180581
Pharos: Q9H228(Tclin)
UniProt: Q9H228
LinkDB
Position
19p13.2
AA seq 398 aa
MESGLLRPAPVSEVIVLHYNYTGKLRGARYQPGAGLRADAVVCLAVCAFIVLENLAVLLV
LGRHPRFHAPMFLLLGSLTLSDLLAGAAYAANILLSGPLTLKLSPALWFAREGGVFVALT
ASVLSLLAIALERSLTMARRGPAPVSSRGRTLAMAAAAWGVSLLLGLLPALGWNCLGRLD
ACSTVLPLYAKAYVLFCVLAFVGILAAICALYARIYCQVRANARRLPARPGTAGTTSTRA
RRKPRSLALLRTLSVVLLAFVACWGPLFLLLLLDVACPARTCPVLLQADPFLGLAMANSL
LNPIIYTLTNRDLRHALLRLVCCGRHSCGRDPSGSQQSASAAEASGGLRRCLPPGLDGSF
SGSERSSPQRDGLDTSGSTGSPGAPTAARTLVSEPAAD
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggagtcggggctgctgcggccggcgccggtgagcgaggtcatcgtcctgcattacaac
tacaccggcaagctccgcggtgcgcgctaccagccgggtgccggcctgcgcgccgacgcc
gtggtgtgcctggcggtgtgcgccttcatcgtgctagagaatctagccgtgttgttggtg
ctcggacgccacccgcgcttccacgctcccatgttcctgctcctgggcagcctcacgttg
tcggatctgctggcaggcgccgcctacgccgccaacatcctactgtcggggccgctcacg
ctgaaactgtcccccgcgctctggttcgcacgggagggaggcgtcttcgtggcactcact
gcgtccgtgctgagcctcctggccatcgcgctggagcgcagcctcaccatggcgcgcagg
gggcccgcgcccgtctccagtcgggggcgcacgctggcgatggcagccgcggcctggggc
gtgtcgctgctcctcgggctcctgccagcgctgggctggaattgcctgggtcgcctggac
gcttgctccactgtcttgccgctctacgccaaggcctacgtgctcttctgcgtgctcgcc
ttcgtgggcatcctggccgctatctgtgcactctacgcgcgcatctactgccaggtacgc
gccaacgcgcggcgcctgccggcacggcccgggactgcggggaccacctcgacccgggcg
cgtcgcaagccgcgctcgctggccttgctgcgcacgctcagcgtggtgctcctggccttt
gtggcatgttggggccccctcttcctgctgctgttgctcgacgtggcgtgcccggcgcgc
acctgtcctgtactcctgcaggccgatcccttcctgggactggccatggccaactcactt
ctgaaccccatcatctacacgctcaccaaccgcgacctgcgccacgcgctcctgcgcctg
gtctgctgcggacgccactcctgcggcagagacccgagtggctcccagcagtcggcgagc
gcggctgaggcttccgggggcctgcgccgctgcctgcccccgggccttgatgggagcttc
agcggctcggagcgctcatcgccccagcgcgacgggctggacaccagcggctccacaggc
agccccggtgcacccacagccgcccggactctggtatcagaaccggctgcagactga

KEGG   Homo sapiens (human): 8698
Entry
8698              CDS       T01001                                 

Gene name
S1PR4, EDG6, LPC1, S1P4, SLP4
Definition
(RefSeq) sphingosine-1-phosphate receptor 4
  KO
K04293  sphingosine 1-phosphate receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967<US> D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    8698 (S1PR4)
   04071 Sphingolipid signaling pathway
    8698 (S1PR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    8698 (S1PR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8698 (S1PR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    8698 (S1PR4)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 8698
NCBI-ProteinID: NP_003766
OMIM: 603751
HGNC: 3170
Ensembl: ENSG00000125910
Vega: OTTHUMG00000180672
Pharos: O95977(Tclin)
UniProt: O95977
LinkDB
Position
19p13.3
AA seq 384 aa
MNATGTPVAPESCQQLAAGGHSRLIVLHYNHSGRLAGRGGPEDGGLGALRGLSVAASCLV
VLENLLVLAAITSHMRSRRWVYYCLVNITLSDLLTGAAYLANVLLSGARTFRLAPAQWFL
REGLLFTALAASTFSLLFTAGERFATMVRPVAESGATKTSRVYGFIGLCWLLAALLGMLP
LLGWNCLCAFDRCSSLLPLYSKRYILFCLVIFAGVLATIMGLYGAIFRLVQASGQKAPRP
AARRKARRLLKTVLMILLAFLVCWGPLFGLLLADVFGSNLWAQEYLRGMDWILALAVLNS
AVNPIIYSFRSREVCRAVLSFLCCGCLRLGMRGPGDCLARAVEAHSGASTTDSSLRPRDS
FRGSRSLSFRMREPLSSISSVRSI
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgaacgccacggggaccccggtggcccccgagtcctgccaacagctggcggccggcggg
cacagccggctcattgttctgcactacaaccactcgggccggctggccgggcgcgggggg
ccggaggatggcggcctgggggccctgcgggggctgtcggtggccgccagctgcctggtg
gtgctggagaacttgctggtgctggcggccatcaccagccacatgcggtcgcgacgctgg
gtctactattgcctggtgaacatcacgctgagtgacctgctcacgggcgcggcctacctg
gccaacgtgctgctgtcgggggcccgcaccttccgtctggcgcccgcccagtggttccta
cgggagggcctgctcttcaccgccctggccgcctccaccttcagcctgctcttcactgca
ggggagcgctttgccaccatggtgcggccggtggccgagagcggggccaccaagaccagc
cgcgtctacggcttcatcggcctctgctggctgctggccgcgctgctggggatgctgcct
ttgctgggctggaactgcctgtgcgcctttgaccgctgctccagccttctgcccctctac
tccaagcgctacatcctcttctgcctggtgatcttcgccggcgtcctggccaccatcatg
ggcctctatggggccatcttccgcctggtgcaggccagcgggcagaaggccccacgccca
gcggcccgccgcaaggcccgccgcctgctgaagacggtgctgatgatcctgctggccttc
ctggtgtgctggggcccactcttcgggctgctgctggccgacgtctttggctccaacctc
tgggcccaggagtacctgcggggcatggactggatcctggccctggccgtcctcaactcg
gcggtcaaccccatcatctactccttccgcagcagggaggtgtgcagagccgtgctcagc
ttcctctgctgcgggtgtctccggctgggcatgcgagggcccggggactgcctggcccgg
gccgtcgaggctcactccggagcttccaccaccgacagctctctgaggccaagggacagc
tttcgcggctcccgctcgctcagctttcggatgcgggagcccctgtccagcatctccagc
gtgcggagcatctga

KEGG   Homo sapiens (human): 9294
Entry
9294              CDS       T01001                                 

Gene name
S1PR2, AGR16, DFNB68, EDG-5, EDG5, Gpcr13, H218, LPB2, S1P2
Definition
(RefSeq) sphingosine-1-phosphate receptor 2
  KO
K04292  sphingosine 1-phosphate receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Disease
H00605  Deafness, autosomal recessive
Drug target
Amiselimod (DG02399): D10904 D10905
Etrasimod (DG02444): D10930
Ozanimod (DG02827): D10967<US> D10968
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    9294 (S1PR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9294 (S1PR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9294 (S1PR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Sphingolipid
    9294 (S1PR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Other DBs
NCBI-GeneID: 9294
NCBI-ProteinID: NP_004221
OMIM: 605111
HGNC: 3169
Ensembl: ENSG00000267534
Vega: OTTHUMG00000180399
Pharos: O95136(Tchem)
UniProt: O95136 A0A024R7B2
LinkDB
Position
19p13.2
AA seq 353 aa
MGSLYSEYLNPNKVQEHYNYTKETLETQETTSRQVASAFIVILCCAIVVENLLVLIAVAR
NSKFHSAMYLFLGNLAASDLLAGVAFVANTLLSGSVTLRLTPVQWFAREGSAFITLSASV
FSLLAIAIERHVAIAKVKLYGSDKSCRMLLLIGASWLISLVLGGLPILGWNCLGHLEACS
TVLPLYAKHYVLCVVTIFSIILLAIVALYVRIYCVVRSSHADMAAPQTLALLKTVTIVLG
VFIVCWLPAFSILLLDYACPVHSCPILYKAHYFFAVSTLNSLLNPVIYTWRSRDLRREVL
RPLQCWRPGVGVQGRRRGGTPGHHLLPLRSSSSLERGMHMPTSPTFLEGNTVV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgggcagcttgtactcggagtacctgaaccccaacaaggtccaggaacactataattat
accaaggagacgctggaaacgcaggagacgacctcccgccaggtggcctcggccttcatc
gtcatcctctgttgcgccattgtggtggaaaaccttctggtgctcattgcggtggcccga
aacagcaagttccactcggcaatgtacctgtttctgggcaacctggccgcctccgatcta
ctggcaggcgtggccttcgtagccaataccttgctctctggctctgtcacgctgaggctg
acgcctgtgcagtggtttgcccgggagggctctgccttcatcacgctctcggcctctgtc
ttcagcctcctggccatcgccattgagcgccacgtggccattgccaaggtcaagctgtat
ggcagcgacaagagctgccgcatgcttctgctcatcggggcctcgtggctcatctcgctg
gtcctcggtggcctgcccatccttggctggaactgcctgggccacctcgaggcctgctcc
actgtcctgcctctctacgccaagcattatgtgctgtgcgtggtgaccatcttctccatc
atcctgttggccatcgtggccctgtacgtgcgcatctactgcgtggtccgctcaagccac
gctgacatggccgccccgcagacgctagccctgctcaagacggtcaccatcgtgctaggc
gtctttatcgtctgctggctgcccgccttcagcatcctccttctggactatgcctgtccc
gtccactcctgcccgatcctctacaaagcccactactttttcgccgtctccaccctgaat
tccctgctcaaccccgtcatctacacgtggcgcagccgggacctgcggcgggaggtgctt
cggccgctgcagtgctggaggccgggggtgggggtgcaaggacggaggcggggcgggacc
ccgggccaccacctcctgccactccgcagctccagctccctggagaggggcatgcacatg
cccacgtcacccacgtttctggagggcaacacggtggtctga

DBGET integrated database retrieval system