KEGG   Homo sapiens (human): 1902Help
Entry
1902              CDS       T01001                                 

Gene name
LPAR1, EDG2, GPR26, Gpcr26, LPA1, Mrec1.3, VZG1, edg-2, rec.1.3, vzg-1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04540  Gap junction
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (virus)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1902 (LPAR1)
   04072 Phospholipase D signaling pathway
    1902 (LPAR1)
   04151 PI3K-Akt signaling pathway
    1902 (LPAR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1902 (LPAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1902 (LPAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1902 (LPAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1902 (LPAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1902 (LPAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    1902 (LPAR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7tm_4
Motif
Other DBs
NCBI-GeneID: 1902
NCBI-ProteinID: NP_001392
OMIM: 602282
HGNC: 3166
Ensembl: ENSG00000198121
Vega: OTTHUMG00000020486
Pharos: Q92633(Tchem)
UniProt: Q92633 Q5VZX0
LinkDB All DBs
Position
9q31.3
AA seq 364 aa AA seqDB search
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatctctacttccatccctgtaatttcacagccccagttcacagccatgaat
gaaccacagtgcttctacaacgagtccattgccttcttttataaccgaagtggaaagcat
cttgccacagaatggaacacagtcagcaagctggtgatgggacttggaatcactgtttgt
atcttcatcatgttggccaacctattggtcatggtggcaatctatgtcaaccgccgcttc
cattttcctatttattacctaatggctaatctggctgctgcagacttctttgctgggttg
gcctacttctatctcatgttcaacacaggacccaatactcggagactgactgttagcaca
tggctccttcgtcagggcctcattgacaccagcctgacggcatctgtggccaacttactg
gctattgcaatcgagaggcacattacggttttccgcatgcagctccacacacggatgagc
aaccggcgggtagtggtggtcattgtggtcatctggactatggccatcgttatgggtgct
atacccagtgtgggctggaactgtatctgtgatattgaaaattgttccaacatggcaccc
ctctacagtgactcttacttagtcttctgggccattttcaacttggtgacctttgtggta
atggtggttctctatgctcacatctttggctatgttcgccagaggactatgagaatgtct
cggcatagttctggaccccggcggaatcgggataccatgatgagtcttctgaagactgtg
gtcattgtgcttggggcctttatcatctgctggactcctggattggttttgttacttcta
gacgtgtgctgtccacagtgcgacgtgctggcctatgagaaattcttccttctccttgct
gaattcaactctgccatgaaccccatcatttactcctaccgcgacaaagaaatgagcgcc
acctttaggcagatcctctgctgccagcgcagtgagaaccccaccggccccacagaaggc
tcagaccgctcggcttcctccctcaaccacaccatcttggctggagttcacagcaatgac
cactctgtggtttag

DBGET integrated database retrieval system