KEGG   Homo sapiens (human): 1902
Entry
1902              CDS       T01001                                 

Gene name
LPAR1, EDG2, GPR26, Gpcr26, LPA1, Mrec1.3, VZG1, edg-2, rec.1.3, vzg-1
Definition
(RefSeq) lysophosphatidic acid receptor 1
  KO
K04289  lysophosphatidic acid receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04540  Gap junction
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    1902 (LPAR1)
   04072 Phospholipase D signaling pathway
    1902 (LPAR1)
   04151 PI3K-Akt signaling pathway
    1902 (LPAR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1902 (LPAR1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    1902 (LPAR1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    1902 (LPAR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1902 (LPAR1)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    1902 (LPAR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1902 (LPAR1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    1902 (LPAR1)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 1902
NCBI-ProteinID: NP_001392
OMIM: 602282
HGNC: 3166
Ensembl: ENSG00000198121
Vega: OTTHUMG00000020486
Pharos: Q92633(Tchem)
UniProt: Q92633 Q5VZX0
LinkDB
Position
9q31.3
AA seq 364 aa
MAAISTSIPVISQPQFTAMNEPQCFYNESIAFFYNRSGKHLATEWNTVSKLVMGLGITVC
IFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTVST
WLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTMAIVMGA
IPSVGWNCICDIENCSNMAPLYSDSYLVFWAIFNLVTFVVMVVLYAHIFGYVRQRTMRMS
RHSSGPRRNRDTMMSLLKTVVIVLGAFIICWTPGLVLLLLDVCCPQCDVLAYEKFFLLLA
EFNSAMNPIIYSYRDKEMSATFRQILCCQRSENPTGPTEGSDRSASSLNHTILAGVHSND
HSVV
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggctgccatctctacttccatccctgtaatttcacagccccagttcacagccatgaat
gaaccacagtgcttctacaacgagtccattgccttcttttataaccgaagtggaaagcat
cttgccacagaatggaacacagtcagcaagctggtgatgggacttggaatcactgtttgt
atcttcatcatgttggccaacctattggtcatggtggcaatctatgtcaaccgccgcttc
cattttcctatttattacctaatggctaatctggctgctgcagacttctttgctgggttg
gcctacttctatctcatgttcaacacaggacccaatactcggagactgactgttagcaca
tggctccttcgtcagggcctcattgacaccagcctgacggcatctgtggccaacttactg
gctattgcaatcgagaggcacattacggttttccgcatgcagctccacacacggatgagc
aaccggcgggtagtggtggtcattgtggtcatctggactatggccatcgttatgggtgct
atacccagtgtgggctggaactgtatctgtgatattgaaaattgttccaacatggcaccc
ctctacagtgactcttacttagtcttctgggccattttcaacttggtgacctttgtggta
atggtggttctctatgctcacatctttggctatgttcgccagaggactatgagaatgtct
cggcatagttctggaccccggcggaatcgggataccatgatgagtcttctgaagactgtg
gtcattgtgcttggggcctttatcatctgctggactcctggattggttttgttacttcta
gacgtgtgctgtccacagtgcgacgtgctggcctatgagaaattcttccttctccttgct
gaattcaactctgccatgaaccccatcatttactcctaccgcgacaaagaaatgagcgcc
acctttaggcagatcctctgctgccagcgcagtgagaaccccaccggccccacagaaggc
tcagaccgctcggcttcctccctcaaccacaccatcttggctggagttcacagcaatgac
cactctgtggtttag

KEGG   Homo sapiens (human): 23566
Entry
23566             CDS       T01001                                 

Gene name
LPAR3, EDG7, Edg-7, GPCR, HOFNH30, LP-A3, LPA3, RP4-678I3
Definition
(RefSeq) lysophosphatidic acid receptor 3
  KO
K04294  lysophosphatidic acid receptor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    23566 (LPAR3)
   04072 Phospholipase D signaling pathway
    23566 (LPAR3)
   04151 PI3K-Akt signaling pathway
    23566 (LPAR3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    23566 (LPAR3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    23566 (LPAR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    23566 (LPAR3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    23566 (LPAR3)
SSDB
Motif
Pfam: 7tm_1 7tm_4
Other DBs
NCBI-GeneID: 23566
NCBI-ProteinID: NP_036284
OMIM: 605106
HGNC: 14298
Ensembl: ENSG00000171517
Vega: OTTHUMG00000009925
Pharos: Q9UBY5(Tchem)
UniProt: Q9UBY5
LinkDB
Position
1p22.3
AA seq 353 aa
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
NT seq 1062 nt   +upstreamnt  +downstreamnt
atgaatgagtgtcactatgacaagcacatggactttttttataataggagcaacactgat
actgtcgatgactggacaggaacaaagcttgtgattgttttgtgtgttgggacgtttttc
tgcctgtttatttttttttctaattctctggtcatcgcggcagtgatcaaaaacagaaaa
tttcatttccccttctactacctgttggctaatttagctgctgccgatttcttcgctgga
attgcctatgtattcctgatgtttaacacaggcccagtttcaaaaactttgactgtcaac
cgctggtttctccgtcaggggcttctggacagtagcttgactgcttccctcaccaacttg
ctggttatcgccgtggagaggcacatgtcaatcatgaggatgcgggtccatagcaacctg
accaaaaagagggtgacactgctcattttgcttgtctgggccatcgccatttttatgggg
gcggtccccacactgggctggaattgcctctgcaacatctctgcctgctcttccctggcc
cccatttacagcaggagttaccttgttttctggacagtgtccaacctcatggccttcctc
atcatggttgtggtgtacctgcggatctacgtgtacgtcaagaggaaaaccaacgtcttg
tctccgcatacaagtgggtccatcagccgccggaggacacccatgaagctaatgaagacg
gtgatgactgtcttaggggcgtttgtggtatgctggaccccgggcctggtggttctgctc
ctcgacggcctgaactgcaggcagtgtggcgtgcagcatgtgaaaaggtggttcctgctg
ctggcgctgctcaactccgtcgtgaaccccatcatctactcctacaaggacgaggacatg
tatggcaccatgaagaagatgatctgctgcttctctcaggagaacccagagaggcgtccc
tctcgcatcccctccacagtcctcagcaggagtgacacaggcagccagtacatagaggat
agtattagccaaggtgcagtctgcaataaaagcacttcctaa

KEGG   Homo sapiens (human): 2846
Entry
2846              CDS       T01001                                 

Gene name
LPAR4, GPR23, LPA4, P2RY9, P2Y5-LIKE, P2Y9
Definition
(RefSeq) lysophosphatidic acid receptor 4
  KO
K04275  lysophosphatidic acid receptor 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2846 (LPAR4)
   04072 Phospholipase D signaling pathway
    2846 (LPAR4)
   04151 PI3K-Akt signaling pathway
    2846 (LPAR4)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2846 (LPAR4)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2846 (LPAR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2846 (LPAR4)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2846 (LPAR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2846 (LPAR4)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    2846 (LPAR4)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx Serpentine_r_xa 7TM_GPCR_Srx
Other DBs
NCBI-GeneID: 2846
NCBI-ProteinID: NP_001264929
OMIM: 300086
HGNC: 4478
Ensembl: ENSG00000147145
Vega: OTTHUMG00000021895
Pharos: Q99677(Tchem)
UniProt: Q99677
LinkDB
Position
Xq21.1
AA seq 370 aa
MGDRRFIDFQFQDSNSSLRPRLGNATANNTCIVDDSFKYNLNGAVYSVVFILGLITNSVS
LFVFCFRMKMRSETAIFITNLAVSDLLFVCTLPFKIFYNFNRHWPFGDTLCKISGTAFLT
NIYGSMLFLTCISVDRFLAIVYPFRSRTIRTRRNSAIVCAGVWILVLSGGISASLFSTTN
VNNATTTCFEGFSKRVWKTYLSKITIFIEVVGFIIPLILNVSCSSVVLRTLRKPATLSQI
GTNKKKVLKMITVHMAVFVVCFVPYNSVLFLYALVRSQAITNCFLERFAKIMYPITLCLA
TLNCCFDPFIYYFTLESFQKSFYINAHIRMESLFKTETPLTTKPSLPAIQEEVSDQTTNN
GGELMLESTF
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgggtgacagaagattcattgacttccaattccaagattcaaattcaagcctcagaccc
aggttgggcaatgctactgccaataatacttgcattgttgatgattccttcaagtataat
ctcaatggtgctgtctacagtgttgtattcatcttgggtctgataaccaacagtgtctct
ctgtttgtcttctgtttccgcatgaaaatgagaagtgagactgctatttttatcaccaat
ctagctgtctctgatttgctttttgtctgtacactaccttttaaaatattttacaacttc
aaccgccactggccttttggtgacaccctctgcaagatctctggaactgcattccttacc
aacatctatgggagcatgctctttctcacctgtattagtgtggatcgtttcctggccatt
gtctatccttttcgatctcgtactattaggactaggaggaattctgccattgtgtgtgct
ggtgtctggatcctagtcctcagtggcggtatttcagcctctttgttttccaccactaat
gtcaacaatgcaaccaccacctgctttgaaggcttctccaaacgtgtctggaagacttat
ttatccaagatcacaatatttattgaagttgttgggtttatcattcctctaatattgaat
gtctcttgctcttctgtggtgctgagaactcttcgcaagcctgctactctgtctcaaatt
gggaccaataagaaaaaagtactgaaaatgatcacagtacatatggcagtctttgtggta
tgctttgtaccctacaactctgtcctcttcttgtatgccctggtgcgctcccaagctatt
actaattgctttttggaaagatttgcaaagatcatgtacccaatcaccttgtgccttgca
actctgaactgttgttttgaccctttcatctattacttcacccttgaatcctttcagaag
tccttctacatcaatgcccacatcagaatggagtccctgtttaagactgaaacacctttg
accacaaagccttcccttccagctattcaagaggaagtgagtgatcaaacaacaaataat
ggtggtgaattaatgctagaatccaccttttag

KEGG   Homo sapiens (human): 9170
Entry
9170              CDS       T01001                                 

Gene name
LPAR2, EDG-4, EDG4, LPA-2, LPA2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses and bacteria)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00408  LPAR-GNB/G-Rho signaling pathway
N01097  LPA-GNA12/13-RhoA signaling pathway
N01104  LPA-GNAQ/11-RhoA signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9170 (LPAR2)
   04072 Phospholipase D signaling pathway
    9170 (LPAR2)
   04151 PI3K-Akt signaling pathway
    9170 (LPAR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9170 (LPAR2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    9170 (LPAR2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9170 (LPAR2)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    9170 (LPAR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9170 (LPAR2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    9170 (LPAR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srt
Other DBs
NCBI-GeneID: 9170
NCBI-ProteinID: NP_004711
OMIM: 605110
HGNC: 3168
Ensembl: ENSG00000064547
Vega: OTTHUMG00000182328
Pharos: Q9HBW0(Tchem)
UniProt: Q9HBW0 A0A024R7M9
LinkDB
Position
19p13.11
AA seq 351 aa
MVIMGQCYYNETIGFFYNNSGKELSSHWRPKDVVVVALGLTVSVLVLLTNLLVIAAIASN
RRFHQPIYYLLGNLAAADLFAGVAYLFLMFHTGPRTARLSLEGWFLRQGLLDTSLTASVA
TLLAIAVERHRSVMAVQLHSRLPRGRVVMLIVGVWVAALGLGLLPAHSWHCLCALDRCSR
MAPLLSRSYLAVWALSSLLVFLLMVAVYTRIFFYVRRRVQRMAEHVSCHPRYRETTLSLV
KTVVIILGAFVVCWTPGQVVLLLDGLGCESCNVLAVEKYFLLLAEANSLVNAAVYSCRDA
EMRRTFRRLLCCACLRQSTRESVHYTSSAQGGASTRIMLPENGHPLMDSTL
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggtcatcatgggccagtgctactacaacgagaccatcggcttcttctataacaacagt
ggcaaagagctcagctcccactggcggcccaaggatgtggtcgtggtggcactggggctg
accgtcagcgtgctggtgctgctgaccaatctgctggtcatagcagccatcgcctccaac
cgccgcttccaccagcccatctactacctgctcggcaatctggccgcggctgacctcttc
gcgggcgtggcctacctcttcctcatgttccacactggtccccgcacagcccgactttca
cttgagggctggttcctgcggcagggcttgctggacacaagcctcactgcgtcggtggcc
acactgctggccatcgccgtggagcggcaccgcagtgtgatggccgtgcagctgcacagc
cgcctgccccgtggccgcgtggtcatgctcattgtgggcgtgtgggtggctgccctgggc
ctggggctgctgcctgcccactcctggcactgcctctgtgccctggaccgctgctcacgc
atggcacccctgctcagccgctcctatttggccgtctgggctctgtcgagcctgcttgtc
ttcctgctcatggtggctgtgtacacccgcattttcttctacgtgcggcggcgagtgcag
cgcatggcagagcatgtcagctgccacccccgctaccgagagaccacgctcagcctggtc
aagactgttgtcatcatcctgggggcgttcgtggtctgctggacaccaggccaggtggta
ctgctcctggatggtttaggctgtgagtcctgcaatgtcctggctgtagaaaagtacttc
ctactgttggccgaggccaactccctggtcaatgctgctgtgtactcttgccgagatgct
gagatgcgccgcaccttccgccgccttctctgctgcgcgtgcctccgccagtccacccgc
gagtctgtccactatacatcctctgcccagggaggtgccagcactcgcatcatgcttccc
gagaacggccacccactgatggactccaccctttag

DBGET integrated database retrieval system