KEGG   Homo sapiens (human): 1906Help
Entry
1906              CDS       T01001                                 

Gene name
EDN1, ARCND3, ET1, HDLCQ7, PPET1, QME
Definition
(RefSeq) endothelin 1
  KO
K16366  endothelin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04668  TNF signaling pathway
hsa04916  Melanogenesis
hsa04924  Renin secretion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
hsa05410  Hypertrophic cardiomyopathy (HCM)
hsa05418  Fluid shear stress and atherosclerosis
Disease
H01884  Auriculocondylar syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    1906 (EDN1)
   04066 HIF-1 signaling pathway
    1906 (EDN1)
   04024 cAMP signaling pathway
    1906 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1906 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    1906 (EDN1)
   04916 Melanogenesis
    1906 (EDN1)
   04924 Renin secretion
    1906 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1906 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1906 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    1906 (EDN1)
   05410 Hypertrophic cardiomyopathy (HCM)
    1906 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    1906 (EDN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Endothelin
Motif
Other DBs
NCBI-GeneID: 1906
NCBI-ProteinID: NP_001946
OMIM: 131240
HGNC: 3176
Ensembl: ENSG00000078401
Vega: OTTHUMG00000014266
Pharos: P05305(Tbio)
CPD: C16009 C16010
UniProt: P05305 Q6FH53
LinkDB All DBs
Structure
PDB: 

Position
6p24.1
AA seq 212 aa AA seqDB search
MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSVKSSFHDPKLKGKPSRERYVTHNRAHW
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atggattatttgctcatgattttctctctgctgtttgtggcttgccaaggagctccagaa
acagcagtcttaggcgctgagctcagcgcggtgggtgagaacggcggggagaaacccact
cccagtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgtt
gttccgtatggacttggaagccctaggtccaagagagccttggagaatttacttcccaca
aaggcaacagaccgtgaaaatagatgccaatgtgctagccaaaaagacaagaagtgctgg
aatttttgccaagcaggaaaagaactcagggctgaagacattatggagaaagactggaat
aatcataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagtta
gtgagaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggag
accatgagaaacagcgtcaaatcatcttttcatgatcccaagctgaaaggcaagccctcc
agagagcgttatgtgacccacaaccgagcacattggtga

DBGET integrated database retrieval system