KEGG   Homo sapiens (human): 1909Help
Entry
1909              CDS       T01001                                 

Gene name
EDNRA, ET-A, ETA, ETA-R, ETAR, ETRA, MFDA, hET-AR
Definition
(RefSeq) endothelin receptor type A
  KO
K04197  endothelin receptor type A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04270  Vascular smooth muscle contraction
hsa04924  Renin secretion
hsa05200  Pathways in cancer
Disease
H02126  Mandibulofacial dysostosis with alopecia
Drug target
Ambrisentan: D07077
Aprocitentan: D11441
Atrasentan hydrochloride: D03009
Bosentan (DG00266): D01227 D07538
Clazosentan sodium: D07682
Edonentan: D03953
Fandosentan potassium: D04128
Macitentan: D10135
Sitaxentan (DG00267): D07171 D08517
Zibotentan: D07741
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1909 (EDNRA)
   04024 cAMP signaling pathway
    1909 (EDNRA)
   04022 cGMP-PKG signaling pathway
    1909 (EDNRA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1909 (EDNRA)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    1909 (EDNRA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    1909 (EDNRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1909 (EDNRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1909 (EDNRA)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Endothelin
    1909 (EDNRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 1909
NCBI-ProteinID: NP_001948
OMIM: 131243
HGNC: 3179
Ensembl: ENSG00000151617
Vega: OTTHUMG00000161354
Pharos: P25101(Tclin)
UniProt: P25101
LinkDB All DBs
Position
4q31.22-q31.23
AA seq 427 aa AA seqDB search
METLCLRASFWLALVGCVISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLP
SNGSMHNYCPQQTKITSAFKYINTVISCTIFIVGMVGNATLLRIIYQNKCMRNGPNALIA
SLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQKSSVGITVLNLCALS
VDRYRAVASWSRVQGIGIPLVTAIEIVSIWILSFILAIPEAIGFVMVPFEYRGEQHKTCM
LNATSKFMEFYQDVKDWWLFGFYFCMPLVCTAIFYTLMTCEMLNRRNGSLRIALSEHLKQ
RREVAKTVFCLVVIFALCWFPLHLSRILKKTVYNEMDKNRCELLSFLLLMDYIGINLATM
NSCINPIALYFVSKKFKNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRS
SHKDSMN
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaaaccctttgcctcagggcatccttttggctggcactggttggatgtgtaatcagt
gataatcctgagagatacagcacaaatctaagcaatcatgtggatgatttcaccactttt
cgtggcacagagctcagcttcctggttaccactcatcaacccactaatttggtcctaccc
agcaatggctcaatgcacaactattgcccacagcagactaaaattacttcagctttcaaa
tacattaacactgtgatatcttgtactattttcatcgtgggaatggtggggaatgcaact
ctgctcaggatcatttaccagaacaaatgtatgaggaatggccccaacgcgctgatagcc
agtcttgcccttggagaccttatctatgtggtcattgatctccctatcaatgtatttaag
ctgctggctgggcgctggccttttgatcacaatgactttggcgtatttctttgcaagctg
ttcccctttttgcagaagtcctcggtggggatcaccgtcctcaacctctgcgctcttagt
gttgacaggtacagagcagttgcctcctggagtcgtgttcagggaattgggattcctttg
gtaactgccattgaaattgtctccatctggatcctgtcctttatcctggccattcctgaa
gcgattggcttcgtcatggtaccctttgaatataggggtgaacagcataaaacctgtatg
ctcaatgccacatcaaaattcatggagttctaccaagatgtaaaggactggtggctcttc
gggttctatttctgtatgcccttggtgtgcactgcgatcttctacaccctcatgacttgt
gagatgttgaacagaaggaatggcagcttgagaattgccctcagtgaacatcttaagcag
cgtcgagaagtggcaaaaacagttttctgcttggttgtaatttttgctctttgctggttc
cctcttcatttaagccgtatattgaagaaaactgtgtataacgagatggacaagaaccga
tgtgaattacttagtttcttactgctcatggattacatcggtattaacttggcaaccatg
aattcatgtataaaccccatagctctgtattttgtgagcaagaaatttaaaaattgtttc
cagtcatgcctctgctgctgctgttaccagtccaaaagtctgatgacctcggtccccatg
aacggaacaagcatccagtggaagaaccacgatcaaaacaaccacaacacagaccggagc
agccataaggacagcatgaactga

KEGG   Homo sapiens (human): 1910Help
Entry
1910              CDS       T01001                                 

Gene name
EDNRB, ABCDS, ET-B, ET-BR, ETB, ETB1, ETBR, ETRB, HSCR, HSCR2, WS4A
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  endothelin receptor type B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04916  Melanogenesis
hsa04926  Relaxin signaling pathway
hsa05200  Pathways in cancer
Disease
H00054  Nasopharyngeal cancer
H00759  Waardenburg syndrome
H00823  ABCD syndrome
H00910  Hirschsprung disease
Drug target
Aprocitentan: D11441
Bosentan (DG00266): D01227 D07538
Macitentan: D10135
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1910 (EDNRB)
   04022 cGMP-PKG signaling pathway
    1910 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1910 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    1910 (EDNRB)
   04916 Melanogenesis
    1910 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1910 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1910 (EDNRB)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Endothelin
    1910 (EDNRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 1910
NCBI-ProteinID: NP_000106
OMIM: 131244
HGNC: 3180
Ensembl: ENSG00000136160
Vega: OTTHUMG00000017111
Pharos: P24530(Tclin)
UniProt: P24530
LinkDB All DBs
Structure
PDB: 

Position
13q22.3
AA seq 442 aa AA seqDB search
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc
ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg
caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc
agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct
ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc
aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc
acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc
gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac
aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata
cagaaagcctccgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat
cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt
cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc
tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg
ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa
gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac
ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt
ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc
attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc
ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc
ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc
tcatcttga

KEGG   Homo sapiens (human): 623Help
Entry
623               CDS       T01001                                 

Gene name
BDKRB1, B1BKR, B1R, BDKRB2, BKB1R, BKR1, BRADYB1
Definition
(RefSeq) bradykinin receptor B1
  KO
K03915  bradykinin receptor B1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    623 (BDKRB1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    623 (BDKRB1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    623 (BDKRB1)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    623 (BDKRB1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    623 (BDKRB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    623 (BDKRB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    623 (BDKRB1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bradykinin
    623 (BDKRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 623
NCBI-ProteinID: NP_000701
OMIM: 600337
HGNC: 1029
Ensembl: ENSG00000100739
Vega: OTTHUMG00000171412
Pharos: P46663(Tchem)
UniProt: P46663
LinkDB All DBs
Position
14q32.2
AA seq 353 aa AA seqDB search
MASSWPPLELQSSNQSQLFPQNATACDNAPEAWDLLHRVLPTFIISICFFGLLGNLFVLL
VFLLPRRQLNVAEIYLANLAASDLVFVLGLPFWAENIWNQFNWPFGALLCRVINGVIKAN
LFISIFLVVAISQDRYRVLVHPMASRRQQRRRQARVTCVLIWVVGGLLSIPTFLLRSIQA
VPDLNITACILLLPHEAWHFARIVELNILGFLLPLAAIVFFNYHILASLRTREEVSRTRC
GGRKDSKTTALILTLVVAFLVCWAPYHFFAFLEFLFQVQAVRGCFWEDFIDLGLQLANFF
AFTNSSLNPVIYVFVGRLFRTKVWELYKQCTPKSLAPISSSHRKEIFQLFWRN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggcatcatcctggccccctctagagctccaatcctccaaccagagccagctcttccct
caaaatgctacggcctgtgacaatgctccagaagcctgggacctgctgcacagagtgctg
ccaacatttatcatctccatctgtttcttcggcctcctagggaacctttttgtcctgttg
gtcttcctcctgccccggcggcaactgaacgtggcagaaatctacctggccaacctggca
gcctctgatctggtgtttgtcttgggcttgcccttctgggcagagaatatctggaaccag
tttaactggcctttcggagccctcctctgccgtgtcatcaacggggtcatcaaggccaat
ttgttcatcagcatcttcctggtggtggccatcagccaggaccgctaccgcgtgctggtg
caccctatggccagccggaggcagcagcggcggaggcaggcccgggtcacctgcgtgctc
atctgggttgtggggggcctcttgagcatccccacattcctgctgcgatccatccaagcc
gtcccagatctgaacatcaccgcctgcatcctgctcctcccccatgaggcctggcacttt
gcaaggattgtggagttaaatattctgggtttcctcctaccactggctgcgatcgtcttc
ttcaactaccacatcctggcctccctgcgaacgcgggaggaggtcagcaggacaaggtgc
gggggccgcaaggatagcaagaccacagcgctgatcctcacgctcgtggttgccttcctg
gtctgctgggccccttaccacttctttgccttcctggaattcttattccaggtgcaagca
gtccgaggctgcttttgggaggacttcattgacctgggcctgcaattggccaacttcttt
gccttcactaacagctccctgaatccagtaatttatgtctttgtgggccggctcttcagg
accaaggtctgggaactttataaacaatgcacccctaaaagtcttgctccaatatcttca
tcccataggaaagaaatcttccaacttttctggcggaattaa

KEGG   Homo sapiens (human): 624Help
Entry
624               CDS       T01001                                 

Gene name
BDKRB2, B2R, BK-2, BK2, BKR2, BRB2
Definition
(RefSeq) bradykinin receptor B2
  KO
K03916  bradykinin receptor B2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04071  Sphingolipid signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05142  Chagas disease (American trypanosomiasis)
hsa05200  Pathways in cancer
Drug target
Deltibant: D03677
Icatibant: D04492
Labradimil: D08937
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    624 (BDKRB2)
   04071 Sphingolipid signaling pathway
    624 (BDKRB2)
   04022 cGMP-PKG signaling pathway
    624 (BDKRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    624 (BDKRB2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    624 (BDKRB2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    624 (BDKRB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    624 (BDKRB2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    624 (BDKRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    624 (BDKRB2)
  09174 Infectious disease: parasitic
   05142 Chagas disease (American trypanosomiasis)
    624 (BDKRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    624 (BDKRB2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Bradykinin
    624 (BDKRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 624
NCBI-ProteinID: NP_000614
OMIM: 113503
HGNC: 1030
Ensembl: ENSG00000168398
Vega: OTTHUMG00000171408
Pharos: P30411(Tclin)
UniProt: P30411
LinkDB All DBs
Position
14q32.2
AA seq 391 aa AA seqDB search
MFSPWKISMFLSVREDSVPTTASFSADMLNVTLQGPTLNGTFAQSKCPQVEWLGWLNTIQ
PPFLWVLFVLATLENIFVLSVFCLHKSSCTVAEIYLGNLAAADLILACGLPFWAITISNN
FDWLFGETLCRVVNAIISMNLYSSICFLMLVSIDRYLALVKTMSMGRMRGVRWAKLYSLV
IWGCTLLLSSPMLVFRTMKEYSDEGHNVTACVISYPSLIWEVFTNMLLNVVGFLLPLSVI
TFCTMQIMQVLRNNEMQKFKEIQTERRATVLVLVVLLLFIICWLPFQISTFLDTLHRLGI
LSSCQDERIIDVITQIASFMAYSNSCLNPLVYVIVGKRFRKKSWEVYQGVCQKGGCRSEP
IQMENSMGTLRTSISVERQIHKLQDWAGSRQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgttctctccctggaagatatcaatgtttctgtctgttcgtgaggactccgtgcccacc
acggcctctttcagcgccgacatgctcaatgtcaccttgcaagggcccactcttaacggg
acctttgcccagagcaaatgcccccaagtggagtggctgggctggctcaacaccatccag
ccccccttcctctgggtgctgttcgtgctggccaccctagagaacatctttgtcctcagc
gtcttctgcctgcacaagagcagctgcacggtggcagagatctacctggggaacctggcc
gcagcagacctgatcctggcctgcgggctgcccttctgggccatcaccatctccaacaac
ttcgactggctctttggggagacgctctgccgcgtggtgaatgccattatctccatgaac
ctgtacagcagcatctgtttcctgatgctggtgagcatcgaccgctacctggccctggtg
aaaaccatgtccatgggccggatgcgcggcgtgcgctgggccaagctctacagcttggtg
atctgggggtgtacgctgctcctgagctcacccatgctggtgttccggaccatgaaggag
tacagcgatgagggccacaacgtcaccgcttgtgtcatcagctacccatccctcatctgg
gaagtgttcaccaacatgctcctgaatgtcgtgggcttcctgctgcccctgagtgtcatc
accttctgcacgatgcagatcatgcaggtgctgcggaacaacgagatgcagaagttcaag
gagatccagacagagaggagggccacggtgctagtcctggttgtgctgctgctattcatc
atctgctggctgcccttccagatcagcaccttcctggatacgctgcatcgcctcggcatc
ctctccagctgccaggacgagcgcatcatcgatgtaatcacacagatcgcctccttcatg
gcctacagcaacagctgcctcaacccactggtgtacgtgatcgtgggcaagcgcttccga
aagaagtcttgggaggtgtaccagggagtgtgccagaaagggggctgcaggtcagaaccc
attcagatggagaactccatgggcacactgcggacctccatctccgtggaacgccagatt
cacaaactgcaggactgggcagggagcagacagtga

DBGET integrated database retrieval system