KEGG   Homo sapiens (human): 1910Help
Entry
1910              CDS       T01001                                 

Gene name
EDNRB, ABCDS, ET-B, ET-BR, ETB, ETB1, ETBR, ETRB, HSCR, HSCR2, WS4A
Definition
(RefSeq) endothelin receptor type B
  KO
K04198  endothelin receptor type B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04916  Melanogenesis
hsa04926  Relaxin signaling pathway
hsa05200  Pathways in cancer
Disease
H00054  Nasopharyngeal cancer
H00759  Waardenburg syndrome
H00823  ABCD syndrome
H00910  Hirschsprung disease
Drug target
Aprocitentan: D11441
Bosentan (DG00266): D01227 D07538
Macitentan: D10135
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    1910 (EDNRB)
   04022 cGMP-PKG signaling pathway
    1910 (EDNRB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    1910 (EDNRB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    1910 (EDNRB)
   04916 Melanogenesis
    1910 (EDNRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    1910 (EDNRB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    1910 (EDNRB)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Endothelin
    1910 (EDNRB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 1910
NCBI-ProteinID: NP_000106
OMIM: 131244
HGNC: 3180
Ensembl: ENSG00000136160
Vega: OTTHUMG00000017111
Pharos: P24530(Tclin)
UniProt: P24530
LinkDB All DBs
Structure
PDB: 

Position
13q22.3
AA seq 442 aa AA seqDB search
MQPPPSLCGRALVALVLACGLSRIWGEERGFPPDRATPLLQTAEIMTPPTKTLWPKGSNA
SLARSLAPAEVPKGDRTAGSPPRTISPPPCQGPIEIKETFKYINTVVSCLVFVLGIIGNS
TLLRIIYKNKCMRNGPNILIASLALGDLLHIVIDIPINVYKLLAEDWPFGAEMCKLVPFI
QKASVGITVLSLCALSIDRYRAVASWSRIKGIGVPKWTAVEIVLIWVVSVVLAVPEAIGF
DIITMDYKGSYLRICLLHPVQKTAFMQFYKTAKDWWLFSFYFCLPLAITAFFYTLMTCEM
LRKKSGMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSRILKLTLYNQNDPNRCEL
LSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLCCWCQSFEEKQSLEEKQSC
LKFKANDHGYDNFRSSNKYSSS
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
atgcagccgcctccaagtctgtgcggacgcgccctggttgcgctggttcttgcctgcggc
ctgtcgcggatctggggagaggagagaggcttcccgcctgacagggccactccgcttttg
caaaccgcagagataatgacgccacccactaagaccttatggcccaagggttccaacgcc
agtctggcgcggtcgttggcacctgcggaggtgcctaaaggagacaggacggcaggatct
ccgccacgcaccatctcccctcccccgtgccaaggacccatcgagatcaaggagactttc
aaatacatcaacacggttgtgtcctgccttgtgttcgtgctggggatcatcgggaactcc
acacttctgagaattatctacaagaacaagtgcatgcgaaacggtcccaatatcttgatc
gccagcttggctctgggagacctgctgcacatcgtcattgacatccctatcaatgtctac
aagctgctggcagaggactggccatttggagctgagatgtgtaagctggtgcctttcata
cagaaagcctctgtgggaatcactgtgctgagtctatgtgctctgagtattgacagatat
cgagctgttgcttcttggagtagaattaaaggaattggggttccaaaatggacagcagta
gaaattgttttgatttgggtggtctctgtggttctggctgtccctgaagccataggtttt
gatataattacgatggactacaaaggaagttatctgcgaatctgcttgcttcatcccgtt
cagaagacagctttcatgcagttttacaagacagcaaaagattggtggctattcagtttc
tatttctgcttgccattggccatcactgcatttttttatacactaatgacctgtgaaatg
ttgagaaagaaaagtggcatgcagattgctttaaatgatcacctaaagcagagacgggaa
gtggccaaaaccgtcttttgcctggtccttgtctttgccctctgctggcttccccttcac
ctcagcaggattctgaagctcactctttataatcagaatgatcccaatagatgtgaactt
ttgagctttctgttggtattggactatattggtatcaacatggcttcactgaattcctgc
attaacccaattgctctgtatttggtgagcaaaagattcaaaaactgctttaagtcatgc
ttatgctgctggtgccagtcatttgaagaaaaacagtccttggaggaaaagcagtcgtgc
ttaaagttcaaagctaatgatcacggatatgacaacttccgttccagtaataaatacagc
tcatcttga

DBGET integrated database retrieval system