KEGG   Homo sapiens (human): 192111Help
Entry
192111            CDS       T01001                                 

Gene name
PGAM5, BXLBV68
Definition
(RefSeq) PGAM family member 5, mitochondrial serine/threonine protein phosphatase
  KO
K15637  serine/threonine-protein phosphatase PGAM5 [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa04217  Necroptosis
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    192111 (PGAM5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    192111 (PGAM5)
  09143 Cell growth and death
   04217 Necroptosis
    192111 (PGAM5)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     192111 (PGAM5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-GeneID: 192111
NCBI-ProteinID: NP_001164014
OMIM: 614939
HGNC: 28763
Ensembl: ENSG00000247077
Vega: OTTHUMG00000168021
Pharos: Q96HS1(Tbio)
UniProt: Q96HS1
LinkDB All DBs
Structure
PDB: 

Position
12q24.33
AA seq 289 aa AA seqDB search
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDAEPRPAEPPAWAGGARPGPGVWDP
NWDRREPLSLINVRKRNVESGEEELASKLDHYKAKATRHIFLIRHSQYHVDGSLEKDRTL
TPLGREQAELTGLRLASLGLKFNKIVHSSMTRAIETTDIISRHLPGVCKVSTDLLREGAP
IEPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADARQEEDSYEIFICHANVIRYIVCR
ALQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atggcgttccggcaggcgctgcagctggcggcctgcgggctggccgggggctcggccgcc
gtgctcttctcggccgtggcggtagggaagccgcgcgcaggcggggacgcggagccacgc
ccggctgagccgccggcctgggcggggggcgcgcggccgggccccggtgtctgggacccc
aactgggacaggcgagaaccactgtctctgatcaacgtgcggaagaggaacgtggaatct
ggggaagaagagctggcgtccaagctggaccactacaaagccaaggccacgcggcacatc
ttcctcatcaggcattcccagtaccacgtggatggctccctggagaaggaccgcactctg
accccgctgggtcgggagcaggctgaactcactgggctccgcctggcaagcttggggttg
aagtttaataaaatcgtccattcgtctatgacgcgcgccatagagaccaccgatatcatc
agccggcacctgccaggcgtctgcaaagtcagcacagatctgctgcgggaaggcgccccc
atcgagccagacccgcccgtgtctcattggaagccggaagctgtgcagtattacgaagac
ggagcccggatcgaggccgccttccggaactacatccaccgcgcagatgccaggcaggag
gaggacagttacgagatcttcatctgtcacgccaacgtcatccgctacatcgtgtgcaga
gcactgcagtttcctcctgaaggctggctccggctctccctcaataatggcagcatcacc
cacctggtgatccgacccaacggccgagttgcgctcaggaccctcggggacacggggttc
atgcctcccgacaagatcactcgatcctga

DBGET integrated database retrieval system