KEGG   Homo sapiens (human): 1937
Entry
1937              CDS       T01001                                 

Gene name
EEF1G, EF1G, GIG35
Definition
(RefSeq) eukaryotic translation elongation factor 1 gamma
  KO
K03233  elongation factor 1-gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    1937 (EEF1G)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1937 (EEF1G)
   03012 Translation factors [BR:hsa03012]
    1937 (EEF1G)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Trans-acting binding proteins
     1937 (EEF1G)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1937 (EEF1G)
SSDB
Motif
Pfam: EF1G GST_N GST_C GST_C_2 GST_C_3 GST_N_3 GST_N_2
Other DBs
NCBI-GeneID: 1937
NCBI-ProteinID: NP_001395
OMIM: 130593
HGNC: 3213
Ensembl: ENSG00000254772
Vega: OTTHUMG00000167567
Pharos: P26641(Tdark)
UniProt: P26641 Q53YD7
LinkDB
Structure
PDB: 
5JPO 5DQS 1PBU

Position
11q12.3
AA seq 437 aa
MAAGTLYTYPENWRAFKALIAAQYSGAQVRVLSAPPHFHFGQTNRTPEFLRKFPAGKVPA
FEGDDGFCVFESNAIAYYVSNEELRGSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGI
MHHNKQATENAKEEVRRILGLLDAYLKTRTFLVGERVTLADITVVCTLLWLYKQVLEPSF
RQAFPNTNRWFLTCINQPQFRAVLGEVKLCEKMAQFDAKKFAETQPKKDTPRKEKGSREE
KQKPQAERKEEKKAAAPAPEEEMDECEQALAAEPKAKDPFAHLPKSTFVLDEFKRKYSNE
DTLSVALPYFWEHFDKDGWSLWYSEYRFPEELTQTFMSCNLITGMFQRLDKLRKNAFASV
ILFGTNNSSSISGVWVFRGQELAFPLSPDWQVDYESYTWRKLDPGSEETQTLVREYFSWE
GAFQHVGKAFNQGKIFK
NT seq 1314 nt   +upstreamnt  +downstreamnt
atggcggctgggaccctgtacacgtatcctgaaaactggagggccttcaaggctctcatc
gctgctcagtacagcggggctcaggtccgcgtgctctccgcaccaccccacttccatttt
ggccaaaccaaccgcacccctgaatttctccgcaaatttcctgccggcaaggtcccagca
tttgagggtgatgatggattctgtgtgtttgagagcaacgccattgcctactatgtgagc
aatgaggagctgcggggaagtactccagaggcagcagcccaggtggtgcagtgggtgagc
tttgctgattccgatatagtgcccccagccagtacctgggtgttccccaccttgggcatc
atgcaccacaacaaacaggccactgagaatgcaaaggaggaagtgaggcgaattctgggg
ctgctggatgcttacttgaagacgaggacttttctggtgggcgaacgagtgacattggct
gacatcacagttgtctgcaccctgttgtggctctataagcaggttctagagccttctttc
cgccaggcctttcccaataccaaccgctggttcctcacctgcattaaccagccccagttc
cgggctgtcttgggcgaagtgaaactgtgtgagaagatggcccagtttgatgctaaaaag
tttgcagagacccaacctaaaaaggacacaccacggaaagagaagggttcacgggaagag
aagcagaagccccaggctgagcggaaggaggagaaaaaggcggctgcccctgctcctgag
gaggagatggatgaatgtgagcaggcgctggctgctgagcccaaggccaaggaccccttc
gctcacctgcccaagagtacctttgtgttggatgaatttaagcgcaagtactccaatgag
gacacactctctgtggcactgccatatttctgggagcactttgataaggacggctggtcc
ctgtggtactcagagtatcgcttccctgaagaactcactcagaccttcatgagctgcaat
ctcatcactggaatgttccagcgactggacaagctgaggaagaatgccttcgccagtgtc
atcctttttggaaccaacaatagcagctccatttctggagtctgggtcttccgaggccag
gagcttgcctttccgctgagtccagattggcaggtggactacgagtcatacacatggcgg
aaactggatcctggcagcgaggagacccagacgctggttcgagagtacttttcctgggag
ggggccttccagcatgtgggcaaagccttcaatcagggcaagatcttcaagtga

DBGET integrated database retrieval system