KEGG   Homo sapiens (human): 1938Help
Entry
1938              CDS       T01001                                 

Gene name
EEF2, EEF-2, EF-2, EF2, SCA26
Definition
(RefSeq) eukaryotic translation elongation factor 2
  KO
K03234  elongation factor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
hsa04921  Oxytocin signaling pathway
Disease
H00063  Spinocerebellar ataxia (SCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    1938 (EEF2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    1938 (EEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1938 (EEF2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1938 (EEF2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Elongation factors
   1938 (EEF2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   1938 (EEF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_II GTP_EFTU_D2 MMR_HSR1
Motif
Other DBs
NCBI-GeneID: 1938
NCBI-ProteinID: NP_001952
OMIM: 130610
HGNC: 3214
Ensembl: ENSG00000167658
Vega: OTTHUMG00000181790
Pharos: P13639(Tbio)
UniProt: P13639 A0A384N6H1
LinkDB All DBs
Position
19p13.3
AA seq 858 aa AA seqDB search
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGAGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDPANGKFSKSATSPEGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEESQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNSSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacttcacggtagaccagatccgcgccatcatggacaagaaggccaacatccgc
aacatgtctgtcatcgcccacgtggaccatggcaagtccacgctgacagactccctggtg
tgcaaggcgggcatcatcgcctcggcccgggccggggagacacgcttcactgatacccgg
aaggacgagcaggagcgttgcatcaccatcaagtcaactgccatctccctcttctacgag
ctctcggagaatgacttgaacttcatcaagcagagcaaggacggtgccggcttcctcatc
aacctcattgactcccccgggcatgtcgacttctcctcggaggtgactgctgccctccga
gtcaccgatggcgcattggtggtggtggactgcgtgtcaggcgtgtgcgtgcagacggag
acagtgctgcggcaggccattgccgagcgcatcaagcctgtgctgatgatgaacaagatg
gaccgcgccctgctggagctgcagctggagcccgaggagctctaccagactttccagcgc
atcgtggagaacgtgaacgtcatcatctccacctacggcgagggcgagagcggccccatg
ggcaacatcatgatcgatcctgtcctcggtaccgtgggctttgggtctggcctccacggg
tgggccttcaccctgaagcagtttgccgagatgtatgtggccaagttcgccgccaagggg
gagggccagttggggcctgccgagcgggccaagaaagtagaggacatgatgaagaagctg
tggggtgacaggtactttgacccagccaacggcaagttcagcaagtcagccaccagcccc
gaagggaagaagctgccacgcaccttctgccagctgatcctggaccccatcttcaaggtg
tttgatgcgatcatgaatttcaagaaagaggagacagcaaaactgatagagaaactggac
atcaaactggacagcgaggacaaggacaaagaaggcaaacccctgctgaaggctgtgatg
cgccgctggctgcctgccggagacgccttgttgcagatgatcaccatccacctgccctcc
cctgtgacggcccagaagtaccgctgcgagctcctgtacgaggggcccccggacgacgag
gctgccatgggcattaaaagctgtgaccccaaaggccctcttatgatgtatatttccaaa
atggtgccaacctccgacaaaggtcggttctacgcctttggacgagtcttctcggggctg
gtctccactggcctgaaggtcaggatcatggggcccaactatacccctgggaagaaggag
gacctctacctgaagccaatccagagaacaatcttgatgatgggccgctacgtggagccc
atcgaggatgtgccttgtgggaacattgtgggcctcgtgggcgtggaccagttcctggtg
aagacgggcaccatcaccaccttcgagcacgcgcacaacatgcgggtgatgaagttcagc
gtcagccctgttgtcagagtggccgtggaggccaagaacccggctgacctgcccaagctg
gtggaggggctgaagcggctggccaagtccgaccccatggtgcagtgcatcatcgaggag
tcgggagagcatatcatcgcgggcgccggcgagctgcacctggagatctgcctgaaggac
ctggaggaggaccacgcctgcatccccatcaagaaatctgacccggtcgtctcgtaccgc
gagacggtcagtgaagagtcgaacgtgctctgcctctccaagtcccccaacaagcacaac
cggctgtacatgaaggcgcggcccttccccgacggcctggccgaggacatcgataaaggc
gaggtgtccgcccgtcaggagctcaagcagcgggcgcgctacctggccgagaagtacgag
tgggacgtggctgaggcccgcaagatctggtgctttgggcccgacggcaccggccccaac
atcctcaccgacatcaccaagggtgtgcagtacctcaacgagatcaaggacagtgtggtg
gccggcttccagtgggccaccaaggagggcgcactgtgtgaggagaacatgcggggtgtg
cgcttcgacgtccacgacgtcaccctgcacgccgacgccatccaccgcggagggggccag
atcatccccacagcacggcgctgcctctatgccagtgtgctgaccgcccagccacgcctc
atggagcccatctaccttgtggagatccagtgtccagagcaggtggtcggtggcatctac
ggggttttgaacaggaagcggggccacgtgttcgaggagtcccaggtggccggcaccccc
atgtttgtggtcaaggcctatctgcccgtcaacgagtcctttggcttcaccgctgacctg
aggtccaacacgggcggccaggcgttcccccagtgtgtgtttgaccactggcagatcctg
cccggagaccccttcgacaacagcagccgccccagccaggtggtggcggagacccgcaag
cgcaagggcctgaaagaaggcatccctgccctggacaacttcctggacaaattgtag

DBGET integrated database retrieval system