KEGG   Homo sapiens (human): 1942Help
Entry
1942              CDS       T01001                                 

Gene name
EFNA1, B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4
Definition
(RefSeq) ephrin A1
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1942 (EFNA1)
   04015 Rap1 signaling pathway
    1942 (EFNA1)
   04010 MAPK signaling pathway
    1942 (EFNA1)
   04151 PI3K-Akt signaling pathway
    1942 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1942 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1942 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1942 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1942 (EFNA1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1942 (EFNA1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1942 (EFNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1942
NCBI-ProteinID: NP_004419
OMIM: 191164
HGNC: 3221
Ensembl: ENSG00000169242
Vega: OTTHUMG00000035312
Pharos: P20827(Tbio)
UniProt: P20827
LinkDB All DBs
Structure
PDB: 

Position
1q22
AA seq 205 aa AA seqDB search
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc
cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat
gtgcagctgaatgactacgtggacatcatctgtccgcactatgaagatcactctgtggca
gacgctgccatggagcagtacatactgtacctggtggagcatgaggagtaccagctgtgc
cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc
ccggagaagctgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc
aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc
ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccatgacaat
ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt
cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctccttccacttctg
ctgctgcaaaccccgtga

DBGET integrated database retrieval system