KEGG   Homo sapiens (human): 1942Help
Entry
1942              CDS       T01001                                 

Gene name
EFNA1, B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4
Definition
(RefSeq) ephrin A1
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1942 (EFNA1)
   04015 Rap1 signaling pathway
    1942 (EFNA1)
   04010 MAPK signaling pathway
    1942 (EFNA1)
   04151 PI3K-Akt signaling pathway
    1942 (EFNA1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1942 (EFNA1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1942 (EFNA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1942 (EFNA1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1942 (EFNA1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1942 (EFNA1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1942 (EFNA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1942
NCBI-ProteinID: NP_004419
OMIM: 191164
HGNC: 3221
Ensembl: ENSG00000169242
Vega: OTTHUMG00000035312
Pharos: P20827(Tbio)
UniProt: P20827
LinkDB All DBs
Structure
PDB: 

Position
1q22
AA seq 205 aa AA seqDB search
MEFLWAPLLGLCCSLAAADRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVA
DAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEF
KEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIG
HSAAPRLFPLAWTVLLLPLLLLQTP
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctctgggcccctctcttgggtctgtgctgcagtctggccgctgctgatcgc
cacaccgtcttctggaacagttcaaatcccaagttccggaatgaggactacaccatacat
gtgcagctgaatgactacgtggacatcatctgtccgcactatgaagatcactctgtggca
gacgctgccatggagcagtacatactgtacctggtggagcatgaggagtaccagctgtgc
cagccccagtccaaggaccaagtccgctggcagtgcaaccggcccagtgccaagcatggc
ccggagaagctgtctgagaagttccagcgcttcacacctttcaccctgggcaaggagttc
aaagaaggacacagctactactacatctccaaacccatccaccagcatgaagaccgctgc
ttgaggttgaaggtgactgtcagtggcaaaatcactcacagtcctcaggcccatgacaat
ccacaggagaagagacttgcagcagatgacccagaggtgcgggttctacatagcatcggt
cacagtgctgccccacgcctcttcccacttgcctggactgtgctgctccttccacttctg
ctgctgcaaaccccgtga

KEGG   Homo sapiens (human): 1943Help
Entry
1943              CDS       T01001                                 

Gene name
EFNA2, ELF-1, EPLG6, HEK7-L, LERK-6, LERK6
Definition
(RefSeq) ephrin A2
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1943 (EFNA2)
   04015 Rap1 signaling pathway
    1943 (EFNA2)
   04010 MAPK signaling pathway
    1943 (EFNA2)
   04151 PI3K-Akt signaling pathway
    1943 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1943 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1943 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1943 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1943 (EFNA2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1943 (EFNA2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1943 (EFNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1943
NCBI-ProteinID: NP_001396
OMIM: 602756
HGNC: 3222
Ensembl: ENSG00000099617
Vega: OTTHUMG00000180148
Pharos: O43921(Tbio)
UniProt: O43921
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 213 aa AA seqDB search
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctcccgctgctgctcctgctgttaccgctgccgccg
ccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtctac
tggaaccgcagcaaccccaggttccacgcaggcgcgggggacgacggcgggggctacacg
gtggaggtgagcatcaatgactacctggacatctactgcccgcactatggggcgccgctg
ccgccggccgagcgcatggagcactacgtgctgtacatggtcaacggcgagggccacgcc
tcctgcgaccaccgccagcgcggcttcaagcgctgggagtgcaaccggcccgcggcgccc
ggggggccgctcaagttctcggagaagttccagctcttcacgcccttctccctgggcttc
gagttccggcccggccacgagtattactacatctctgccacgcctcccaatgctgtggac
cggccctgcctgcgactgaaggtgtacgtgcggccgaccaacgagaccctgtacgaggct
cctgagcccatcttcaccagcaataactcgtgtagcagcccgggcggctgccgcctcttc
ctcagcaccatccccgtgctctggaccctcctgggttcctag

KEGG   Homo sapiens (human): 1944Help
Entry
1944              CDS       T01001                                 

Gene name
EFNA3, EFL2, EPLG3, Ehk1-L, LERK3
Definition
(RefSeq) ephrin A3
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1944 (EFNA3)
   04015 Rap1 signaling pathway
    1944 (EFNA3)
   04010 MAPK signaling pathway
    1944 (EFNA3)
   04151 PI3K-Akt signaling pathway
    1944 (EFNA3)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1944 (EFNA3)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1944 (EFNA3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1944 (EFNA3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1944 (EFNA3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1944 (EFNA3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1944 (EFNA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin FLYWCH
Motif
Other DBs
NCBI-GeneID: 1944
NCBI-ProteinID: NP_004943
OMIM: 601381
HGNC: 3223
Ensembl: ENSG00000143590
Vega: OTTHUMG00000035313
Pharos: P52797(Tbio)
UniProt: P52797
LinkDB All DBs
Position
1q21.3
AA seq 238 aa AA seqDB search
MAAAPLLLLLLLVPVPLLPLLAQGPGGALGNRHAVYWNSSNQHLRREGYTVQVNVNDYLD
IYCPHYNSSGVGPGAGPGPGGGAEQYVLYMVSRNGYRTCNASQGFKRWECNRPHAPHSPI
KFSEKFQRYSAFSLGYEFHAGHEYYYISTPTHNLHWKCLRMKVFVCCASTSHSGEKPVPT
LPQFTMGPNVKINVLEDFEGENPQVPKLEKSISGTSPKREHLPLAVGIAFFLMTFLAS
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctccgctgctgctgctgctgctgctcgtgcccgtgccgctgctgccgctg
ctggcccaagggcccggaggggcgctgggaaaccggcatgcggtgtactggaacagctcc
aaccagcacctgcggcgagagggctacaccgtgcaggtgaacgtgaacgactatctggat
atttactgcccgcactacaacagctcgggggtgggccccggggcgggaccggggcccgga
ggcggggcagagcagtacgtgctgtacatggtgagccgcaacggctaccgcacctgcaac
gccagccagggcttcaagcgctgggagtgcaaccggccgcacgccccgcacagccccatc
aagttctcggagaagttccagcgctacagcgccttctctctgggctacgagttccacgcc
ggccacgagtactactacatctccacgcccactcacaacctgcactggaagtgtctgagg
atgaaggtgttcgtctgctgcgcctccacatcgcactccggggagaagccggtccccact
ctcccccagttcaccatgggccccaatgtgaagatcaacgtgctggaagactttgaggga
gagaaccctcaggtgcccaagcttgagaagagcatcagcgggaccagccccaaacgggaa
cacctgcccctggccgtgggcatcgccttcttcctcatgacgttcttggcctcctag

KEGG   Homo sapiens (human): 1945Help
Entry
1945              CDS       T01001                                 

Gene name
EFNA4, EFL4, EPLG4, LERK4
Definition
(RefSeq) ephrin A4
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1945 (EFNA4)
   04015 Rap1 signaling pathway
    1945 (EFNA4)
   04010 MAPK signaling pathway
    1945 (EFNA4)
   04151 PI3K-Akt signaling pathway
    1945 (EFNA4)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1945 (EFNA4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1945 (EFNA4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1945 (EFNA4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1945 (EFNA4)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1945 (EFNA4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1945 (EFNA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1945
NCBI-ProteinID: NP_005218
OMIM: 601380
HGNC: 3224
Ensembl: ENSG00000243364
Vega: OTTHUMG00000035309
Pharos: P52798(Tbio)
UniProt: P52798
LinkDB All DBs
Position
1q21.3
AA seq 201 aa AA seqDB search
MRLLPLLRTVLWAAFLGSPLRGGSSLRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPH
YEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSL
GFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESGTSGWRGGDT
PSPLCLLLLLLLLILRLLRIL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctgcccctgctgcggactgtcctctgggccgcgttcctcggctcccctctg
cgcgggggctccagcctccgccacgtagtctactggaactccagtaaccccaggttgctt
cgaggagacgccgtggtggagctgggcctcaacgattacctagacattgtctgcccccac
tacgaaggcccagggccccctgagggccccgagacgtttgctttgtacatggtggactgg
ccaggctatgagtcctgccaggcagagggcccccgggcctacaagcgctgggtgtgctcc
ctgccctttggccatgttcaattctcagagaagattcagcgcttcacacccttctccctc
ggctttgagttcttacctggagagacttactactacatctcggtgcccactccagagagt
tctggccagtgcttgaggctccaggtgtctgtctgctgcaaggagaggaagtctgagtca
gcccatcctgttgggagccctggagagagtggcacatcagggtggcgagggggggacact
cccagccccctctgtctcttgctattactgctgcttctgattcttcgtcttctgcgaatt
ctgtga

KEGG   Homo sapiens (human): 1946Help
Entry
1946              CDS       T01001                                 

Gene name
EFNA5, AF1, EFL5, EPLG7, GLC1M, LERK7, RAGS
Definition
(RefSeq) ephrin A5
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1946 (EFNA5)
   04015 Rap1 signaling pathway
    1946 (EFNA5)
   04010 MAPK signaling pathway
    1946 (EFNA5)
   04151 PI3K-Akt signaling pathway
    1946 (EFNA5)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1946 (EFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1946 (EFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1946 (EFNA5)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1946 (EFNA5)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1946 (EFNA5)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1946 (EFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1946
NCBI-ProteinID: NP_001953
OMIM: 601535
HGNC: 3225
Ensembl: ENSG00000184349
Vega: OTTHUMG00000128741
Pharos: P52803(Tbio)
UniProt: P52803
LinkDB All DBs
Structure
PDB: 

Position
5q21.3
AA seq 228 aa AA seqDB search
MLHVEMLTLVFLVLWMCVFSQDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDV
FCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQL
FTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDK
VENSLEPADDTVHESAEPSRGENAAQTPRIPSRLLAILLFLLAMLLTL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgttgcacgtggagatgttgacgctggtgtttctggtgctctggatgtgtgtgttcagc
caggacccgggctccaaggccgtcgccgaccgctacgctgtctactggaacagcagcaac
cccagattccagaggggtgactaccatattgatgtctgtatcaatgactacctggatgtt
ttctgccctcactatgaggactccgtcccagaagataagactgagcgctatgtcctctac
atggtgaactttgatggctacagtgcctgcgaccacacttccaaagggttcaagagatgg
gaatgtaaccggcctcactctccaaatggaccgctgaagttctctgaaaaattccagctc
ttcactcccttttctctaggatttgaattcaggccaggccgagaatatttctacatctcc
tctgcaatcccagataatggaagaaggtcctgtctaaagctcaaagtctttgtgagacca
acaaatagctgtatgaaaactataggtgttcatgatcgtgttttcgatgttaacgacaaa
gtagaaaattcattagaaccagcagatgacaccgtacatgagtcagccgagccatcccgc
ggcgagaacgcggcacaaacaccaaggatacccagccgccttttggcaatcctactgttc
ctcctggcgatgcttttgacattatag

DBGET integrated database retrieval system