KEGG   Homo sapiens (human): 1943Help
Entry
1943              CDS       T01001                                 

Gene name
EFNA2, ELF-1, EPLG6, HEK7-L, LERK-6, LERK6
Definition
(RefSeq) ephrin A2
  KO
K05462  ephrin-A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    1943 (EFNA2)
   04015 Rap1 signaling pathway
    1943 (EFNA2)
   04010 MAPK signaling pathway
    1943 (EFNA2)
   04151 PI3K-Akt signaling pathway
    1943 (EFNA2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1943 (EFNA2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    1943 (EFNA2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    1943 (EFNA2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    1943 (EFNA2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1943 (EFNA2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Axon guidance molecules
   1943 (EFNA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1943
NCBI-ProteinID: NP_001396
OMIM: 602756
HGNC: 3222
Ensembl: ENSG00000099617
Vega: OTTHUMG00000180148
Pharos: O43921(Tbio)
UniProt: O43921
LinkDB All DBs
Structure
PDB: 

Position
19p13.3
AA seq 213 aa AA seqDB search
MAPAQRPLLPLLLLLLPLPPPPFARAEDAARANSDRYAVYWNRSNPRFHAGAGDDGGGYT
VEVSINDYLDIYCPHYGAPLPPAERMEHYVLYMVNGEGHASCDHRQRGFKRWECNRPAAP
GGPLKFSEKFQLFTPFSLGFEFRPGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEA
PEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLGS
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcgcccgcgcagcgcccgctgctcccgctgctgctcctgctgttaccgctgccgccg
ccgcccttcgcgcgcgccgaggacgccgcccgcgccaactcggaccgctacgccgtctac
tggaaccgcagcaaccccaggttccacgcaggcgcgggggacgacggcgggggctacacg
gtggaggtgagcatcaatgactacctggacatctactgcccgcactatggggcgccgctg
ccgccggccgagcgcatggagcactacgtgctgtacatggtcaacggcgagggccacgcc
tcctgcgaccaccgccagcgcggcttcaagcgctgggagtgcaaccggcccgcggcgccc
ggggggccgctcaagttctcggagaagttccagctcttcacgcccttctccctgggcttc
gagttccggcccggccacgagtattactacatctctgccacgcctcccaatgctgtggac
cggccctgcctgcgactgaaggtgtacgtgcggccgaccaacgagaccctgtacgaggct
cctgagcccatcttcaccagcaataactcgtgtagcagcccgggcggctgccgcctcttc
ctcagcaccatccccgtgctctggaccctcctgggttcctag

DBGET integrated database retrieval system