KEGG   Homo sapiens (human): 1947Help
Entry
1947              CDS       T01001                                 

Gene name
EFNB1, CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2
Definition
(RefSeq) ephrin B1
  KO
K05463  ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H00458  Syndromic craniosynostoses
H01992  Craniofrontonasal syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1947 (EFNB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1947 (EFNB1)
   04052 Cytokines and growth factors [BR:hsa04052]
    1947 (EFNB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1947 (EFNB1)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1947 (EFNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin DUF4381 TMEM132D_C Syndecan Cadherin_C_2 Baculo_11_kDa
Motif
Other DBs
NCBI-GeneID: 1947
NCBI-ProteinID: NP_004420
OMIM: 300035
HGNC: 3226
Ensembl: ENSG00000090776
Vega: OTTHUMG00000021751
Pharos: P98172(Tbio)
UniProt: P98172
LinkDB All DBs
Position
Xq13.1
AA seq 346 aa AA seqDB search
MARPGQRWLGKWLVAMVVWALCRLATPLAKNLEPVSWSSLNPKFLSGKGLVIYPKIGDKL
DIICPRAEAGRPYEYYKLYLVRPEQAAACSTVLDPNVLVTCNRPEQEIRFTIKFQEFSPN
YMGLEFKKHHDYYITSTSNGSLEGLENREGGVCRTRTMKIIMKVGQDPNAVTPEQLTTSR
PSKEADNTVKMATQAPGSRGSLGDSDGKHETVNQEEKSGPGASGGSSGDPDGFFNSKVAL
FAAVGAGCVIFLLIIIFLTVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPS
DIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggctcggcctgggcagcgttggctcggcaagtggcttgtggcgatggtcgtgtgggcg
ctgtgccggctcgccacaccgctggccaagaacctggagcccgtatcctggagctccctc
aaccccaagttcctgagtgggaagggcttggtgatctatccgaaaattggagacaagctg
gacatcatctgcccccgagcagaagcagggcggccctatgagtactacaagctgtacctg
gtgcggcctgagcaggcagctgcctgtagcacagttctcgaccccaacgtgttggtcacc
tgcaataggccagagcaggaaatacgctttaccatcaagttccaggagttcagccccaac
tacatgggcctggagttcaagaagcaccatgattactacattacctcaacatccaatgga
agcctggaggggctggaaaaccgggagggcggtgtgtgccgcacacgcaccatgaagatc
atcatgaaggttgggcaagatcccaatgctgtgacgcctgagcagctgactaccagcagg
cccagcaaggaggcagacaacactgtcaagatggccacacaggcccctggtagtcggggc
tccctgggtgactctgatggcaagcatgagactgtgaaccaggaagagaagagtggccca
ggtgcaagtgggggcagcagcggggaccctgatggcttcttcaactccaaggtggcattg
ttcgcggctgtcggtgccggttgcgtcatcttcctgctcatcatcatcttcctgacggtc
ctactactgaagctacgcaagcggcaccgcaagcacacacagcagcgggcggctgccctc
tcgctcagtaccctggccagtcccaaggggggcagtggcacagcgggcaccgagcccagc
gacatcatcattcccttacggactacagagaacaactactgcccccactatgagaaggtg
agtggggactacgggcaccctgtctacatcgtccaagagatgccgccccagagcccggcg
aacatctactacaaggtctga

KEGG   Homo sapiens (human): 1948Help
Entry
1948              CDS       T01001                                 

Gene name
EFNB2, EPLG5, HTKL, Htk-L, LERK5
Definition
(RefSeq) ephrin B2
  KO
K05463  ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1948 (EFNB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1948 (EFNB2)
   04052 Cytokines and growth factors [BR:hsa04052]
    1948 (EFNB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1948 (EFNB2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1948 (EFNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin TMEM132D_C EphA2_TM RIFIN ECSCR TMEM154 DUF4381
Motif
Other DBs
NCBI-GeneID: 1948
NCBI-ProteinID: NP_004084
OMIM: 600527
HGNC: 3227
Ensembl: ENSG00000125266
Vega: OTTHUMG00000017324
Pharos: P52799(Tbio)
UniProt: P52799
LinkDB All DBs
Structure
PDB: 

Position
13q33.3
AA seq 333 aa AA seqDB search
MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDI
ICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPN
LWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPT
RRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNILGSEVALFAGIASGCIIFIV
IIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGNNNGSEPSDIIIPLRTADSVF
CPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgagaagggactccgtgtggaagtactgctggggtgttttgatggttttatgc
agaactgcgatttccaaatcgatagttttagagcctatctattggaattcctcgaactcc
aaatttctacctggacaaggactggtactatacccacagataggagacaaattggatatt
atttgccccaaagtggactctaaaactgttggccagtatgaatattataaagtttatatg
gttgataaagaccaagcagacagatgcactattaagaaggaaaatacccctctcctcaac
tgtgccaaaccagaccaagatatcaaattcaccatcaagtttcaagaattcagccctaac
ctctggggtctagaatttcagaagaacaaagattattacattatatctacatcaaatggg
tctttggagggcctggataaccaggagggaggggtgtgccagacaagagccatgaagatc
ctcatgaaagttggacaagatgcaagttctgctggatcaaccaggaataaagatccaaca
agacgtccagaactagaagctggtacaaatggaagaagttcgacaacaagtccctttgta
aaaccaaatccaggttctagcacagacggcaacagcgccggacattcggggaacaacatc
ctcggttccgaagtggccttatttgcagggattgcttcaggatgcatcatcttcatcgtc
atcatcatcacgctggtggtcctcttgctgaagtaccggaggagacacaggaagcactcg
ccgcagcacacgaccacgctgtcgctcagcacactggccacacccaagcgcagcggcaac
aacaacggctcagagcccagtgacattatcatcccgctaaggactgcggacagcgtcttc
tgccctcactacgagaaggtcagcggggactacgggcacccggtgtacatcgtccaggag
atgcccccgcagagcccggcgaacatttactacaaggtctga

KEGG   Homo sapiens (human): 1949Help
Entry
1949              CDS       T01001                                 

Gene name
EFNB3, EFL6, EPLG8, LERK8
Definition
(RefSeq) ephrin B3
  KO
K05463  ephrin-B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    1949 (EFNB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    1949 (EFNB3)
   04052 Cytokines and growth factors [BR:hsa04052]
    1949 (EFNB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   1949 (EFNB3)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   1949 (EFNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ephrin
Motif
Other DBs
NCBI-GeneID: 1949
NCBI-ProteinID: NP_001397
OMIM: 602297
HGNC: 3228
Ensembl: ENSG00000108947
Vega: OTTHUMG00000108161
Pharos: Q15768(Tbio)
UniProt: Q15768
LinkDB All DBs
Structure
PDB: 

Position
17p13.1
AA seq 340 aa AA seqDB search
MGPPHSGPGGVRVGALLLLGVLGLVSGLSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDL
LCPRARPPGPHSSPNYEFYKLYLVGGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEY
SPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKP
VSEMPMERDRGAAHSLEPGKENLPGDPTSNATSRGAEGPLPPPSMPAVAGAAGGLALLLL
GVAGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGELGIALRGG
GAADPPFCPHYEKVSGDYGHPVYIVQDGPPQSPPNIYYKV
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggggcccccccattctgggccggggggcgtgcgagtcggggccctgctgctgctgggg
gttttggggctggtgtctgggctcagcctggagcctgtctactggaactcggcgaataag
aggttccaggcagagggtggttatgtgctgtaccctcagatcggggaccggctagacctg
ctctgcccccgggcccggcctcctggccctcactcctctcctaattatgagttctacaag
ctgtacctggtagggggtgctcagggccggcgctgtgaggcaccccctgccccaaacctc
cttctcacttgtgatcgcccagacctggatctccgcttcaccatcaagttccaggagtat
agccctaatctctggggccacgagttccgctcgcaccacgattactacatcattgccaca
tcggatgggacccgggagggcctggagagcctgcagggaggtgtgtgcctaaccagaggc
atgaaggtgcttctccgagtgggacaaagtccccgaggaggggctgtcccccgaaaacct
gtgtctgaaatgcccatggaaagagaccgaggggcagcccacagcctggagcctgggaag
gagaacctgccaggtgaccccaccagcaatgcaacctcccggggtgctgaaggccccctg
ccccctcccagcatgcctgcagtggctggggcagcaggggggctggcgctgctcttgctg
ggcgtggcaggggctgggggtgccatgtgttggcggagacggcgggccaagccttcggag
agtcgccaccctggtcctggctccttcgggaggggagggtctctgggcctggggggtgga
ggtgggatgggacctcgggaggctgagcctggggagctagggatagctctgcggggtggc
ggggctgcagatccccccttctgcccccactatgagaaggtgagtggtgactatgggcat
cctgtgtatatcgtgcaggatgggcccccccagagccctccaaacatctactacaaggta
tga

DBGET integrated database retrieval system