KEGG   Homo sapiens (human): 195814
Entry
195814            CDS       T01001                                 

Gene name
SDR16C5, EPHD-2, RDH#2, RDH-E2, RDHE2, retSDR2
Definition
(RefSeq) short chain dehydrogenase/reductase family 16C member 5
  KO
K15734  all-trans-retinol dehydrogenase (NAD+) [EC:1.1.1.105]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    195814 (SDR16C5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     195814 (SDR16C5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR
Other DBs
NCBI-GeneID: 195814
NCBI-ProteinID: NP_620419
OMIM: 608989
HGNC: 30311
Ensembl: ENSG00000170786
Vega: OTTHUMG00000164311
Pharos: Q8N3Y7(Tbio)
UniProt: Q8N3Y7 B3KT84
LinkDB
Position
8q12.1
AA seq 309 aa
MSFNLQSSKKLFIFLGKSLFSLLEAMIFALLPKPRKNVAGEIVLITGAGSGLGRLLALQF
ARLGSVLVLWDINKEGNEETCKMAREAGATRVHAYTCDCSQKEGVYRVADQVKKEVGDVS
ILINNAGIVTGKKFLDCPDELMEKSFDVNFKAHLWTYKAFLPAMIANDHGHLVCISSSAG
LSGVNGLADYCASKFAAFGFAESVFVETFVQKQKGIKTTIVCPFFIKTGMFEGCTTGCPS
LLPILEPKYAVEKIVEAILQEKMYLYMPKLLYFMMFLKSFLPLKTGLLIADYLGILHAMD
GFVDQKKKL
NT seq 930 nt   +upstreamnt  +downstreamnt
atgtctttcaacctgcaatcatcaaagaaactgttcattttcttaggaaaatcactgttt
agtcttctggaggctatgatttttgccttactcccaaagccacggaagaacgttgctggt
gaaatagtcctcatcacaggtgctggaagtggactcggaaggctcttagccttgcagttt
gcccggctgggatctgttcttgttctctgggatatcaataaggaggggaatgaggaaaca
tgtaagatggctcgggaagctggagccacaagagtgcacgcctatacctgcgattgcagc
caaaaggaaggagtgtatagagtagccgaccaggttaaaaaagaagtcggcgatgtttcc
atcctaatcaacaatgccggaatcgtaacaggcaaaaagttccttgactgtccagatgag
cttatggaaaagtcatttgatgtgaatttcaaagcacatttatggacttataaagccttt
ctacctgctatgattgctaatgaccatggacatttggtttgcatttcaagttcagctgga
ttaagtggagtaaatgggctggcagattactgtgcaagtaaatttgcagcctttgggttt
gctgaatctgtatttgtagaaacatttgtccaaaaacaaaaggggatcaaaaccacgatt
gtgtgccccttttttataaaaactggaatgtttgaaggttgtactacaggctgtccttct
ctgttgccaattctggaaccaaaatatgcagttgaaaaaatagtagaagctattctacaa
gaaaaaatgtacttgtatatgccaaagttgttatacttcatgatgtttcttaaaagcttt
ttgcccctcaagacaggactgcttatagctgactatttgggcatccttcatgcaatggat
ggctttgttgaccaaaagaagaagctctaa

KEGG   Homo sapiens (human): 8630
Entry
8630              CDS       T01001                                 

Gene name
HSD17B6, HSE, RODH, SDR9C6
Definition
(RefSeq) hydroxysteroid 17-beta dehydrogenase 6
  KO
K13369  17beta-estradiol 17-dehydrogenase / all-trans-retinol dehydrogenase (NAD+) / 3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+) [EC:1.1.1.62 1.1.1.105 1.1.1.239]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    8630 (HSD17B6)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    8630 (HSD17B6)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.62  17beta-estradiol 17-dehydrogenase
     8630 (HSD17B6)
    1.1.1.105  all-trans-retinol dehydrogenase (NAD+)
     8630 (HSD17B6)
    1.1.1.239  3alpha(17beta)-hydroxysteroid dehydrogenase (NAD+)
     8630 (HSD17B6)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10
Other DBs
NCBI-GeneID: 8630
NCBI-ProteinID: NP_003716
OMIM: 606623
HGNC: 23316
Ensembl: ENSG00000025423
Vega: OTTHUMG00000170854
Pharos: O14756(Tbio)
UniProt: O14756 A0A024RB43
LinkDB
Position
12q13.3
AA seq 317 aa
MWLYLAAFVGLYYLLHWYRERQVVSHLQDKYVFITGCDSGFGNLLARQLDARGLRVLAAC
LTEKGAEQLRGQTSDRLETVTLDVTKMESIAAATQWVKEHVGDRGLWGLVNNAGILTPIT
LCEWLNTEDSMNMLKVNLIGVIQVTLSMLPLVRRARGRIVNVSSILGRVAFFVGGYCVSK
YGVEAFSDILRREIQHFGVKISIVEPGYFRTGMTNMTQSLERMKQSWKEAPKHIKETYGQ
QYFDALYNIMKEGLLNCSTNLNLVTDCMEHALTSVHPRTRYSAGWDAKFFFIPLSYLPTS
LADYILTRSWPKPAQAV
NT seq 954 nt   +upstreamnt  +downstreamnt
atgtggctctacctggcggccttcgtgggcctgtactaccttctgcactggtaccgggag
aggcaggtggtgagccacctccaagacaagtatgtctttatcacgggctgtgactcgggc
tttgggaacctgctggccagacagctggatgcacgaggcttgagagtgctggctgcgtgt
ctgacggagaagggggccgagcagctgaggggccagacgtctgacaggctggagacggtg
accctggatgttaccaagatggagagcatcgctgcagctactcagtgggtgaaggagcat
gtgggggacagaggactctggggactggtgaacaatgcaggcattcttacaccaattacc
ttatgtgagtggctgaacactgaggactctatgaatatgctcaaagtgaacctcattggt
gtgatccaggtgaccttgagcatgcttcctttggtgaggagagcacggggaagaattgtc
aatgtctccagcattctgggaagagttgctttctttgtaggaggctactgtgtctccaag
tatggagtggaagccttttcagatattctgaggcgtgagattcaacattttggggtgaaa
atcagcatagttgaacctggctacttcagaacgggaatgacaaacatgacacagtcctta
gagcgaatgaagcaaagttggaaagaagcccccaagcatattaaggagacctatggacag
cagtattttgatgccctttacaatatcatgaaggaagggctgttgaattgtagcacaaac
ctgaacctggtcactgactgcatggaacatgctctgacatcggtgcatccgcgaactcga
tattcagctggctgggatgctaaatttttcttcatccctctatcttatttacctacatca
ctggcagactacattttgactagatcttggcccaaaccagcccaggcagtctaa

DBGET integrated database retrieval system