KEGG   Homo sapiens (human): 1959Help
Entry
1959              CDS       T01001                                 

Gene name
EGR2, AT591, CHN1, CMT1D, CMT4E, KROX20
Definition
(RefSeq) early growth response 2
  KO
K12496  early growth response protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06162  Hepatitis B virus (HBV)
  Element
N00509  HTLV-1 Tax to SRF-mediated transcription
N00532  HBV HBx to Egr-mediated transcription
Disease
H00264  Charcot-Marie-Tooth disease
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    1959 (EGR2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1959 (EGR2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    1959 (EGR2)
   05161 Hepatitis B
    1959 (EGR2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1959 (EGR2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1959 (EGR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF3446 zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-BED zf-C2HC_2 Zf_RING zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 1959
NCBI-ProteinID: NP_000390
OMIM: 129010
HGNC: 3239
Ensembl: ENSG00000122877
Vega: OTTHUMG00000018308
Pharos: P11161(Tbio)
UniProt: P11161
LinkDB All DBs
Position
10q21.3
AA seq 476 aa AA seqDB search
MMTAKAVDKIPVTLSGFVHQLSDNIYPVEDLAATSVTIFPNAELGGPFDQMNGVAGDGMI
NIDMTGEKRSLDLPYPSSFAPVSAPRNQTFTYMGKFSIDPQYPGASCYPEGIINIVSAGI
LQGVTSPASTTASSSVTSASPNPLATGPLGVCTMSQTQPDLDHLYSPPPPPPPYSGCAGD
LYQDPSAFLSAATTSTSSSLAYPPPPSYPSPKPATDPGLFPMIPDYPGFFPSQCQRDLHG
TAGPDRKPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSA
AAAAAAAAAYNPHHLPLRPILRPRKYPNRPSKTPVHERPYPCPAEGCDRRFSRSDELTRH
IRIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIH
LRQKERKSSAPSASVPAPSTASCSGGVQPGGTLCSSNSSSLGGGPLAPCSSRTRTP
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgccaaggccgtagacaaaatcccagtaactctcagtggttttgtgcaccag
ctgtctgacaacatctacccggtggaggacctcgccgccacgtcggtgaccatctttccc
aatgccgaactgggaggcccctttgaccagatgaacggagtggccggagatggcatgatc
aacattgacatgactggagagaagaggtcgttggatctcccatatcccagcagctttgct
cccgtctctgcacctagaaaccagaccttcacttacatgggcaagttctccattgaccct
cagtaccctggtgccagctgctacccagaaggcataatcaatattgtgagtgcaggcatc
ttgcaaggggtcacttccccagcttcaaccacagcctcatccagcgtcacctctgcctcc
cccaacccactggccacaggacccctgggtgtgtgcaccatgtcccagacccagcctgac
ctggaccacctgtactctccgccaccgcctcctcctccttattctggctgtgcaggagac
ctctaccaggacccttctgcgttcctgtcagcagccaccacctccacctcttcctctctg
gcctacccaccacctccttcctatccatcccccaagccagccacggacccaggtctcttc
ccaatgatcccagactatcctggattctttccatctcagtgccagagagacctacatggt
acagctggcccagaccgtaagccctttccctgcccactggacaccctgcgggtgccccct
ccactcactccactctctacaatccgtaactttaccctggggggccccagtgctggggtg
accggaccaggggccagtggaggcagcgagggaccccggctgcctggtagcagctcagca
gcagcagcagccgccgccgccgccgcctataacccacaccacctgccactgcggcccatt
ctgaggcctcgcaagtaccccaacagacccagcaagacgccggtgcacgagaggccctac
ccgtgcccagcagaaggctgcgaccggcggttctcccgctctgacgagctgacacggcac
atccgaatccacactgggcataagcccttccagtgtcggatctgcatgcgcaacttcagc
cgcagtgaccacctcaccacccatatccgcacccacaccggtgagaagcccttcgcctgt
gactactgtggccgaaagtttgcccggagtgatgagaggaagcgccacaccaagatccac
ctgagacagaaagagcggaaaagcagtgccccctctgcatcggtgccagccccctctaca
gcctcctgctctgggggcgtgcagcctgggggtaccctgtgcagcagtaacagcagcagt
cttggcggagggccgctcgccccttgctcctctcggacccggacaccttga

KEGG   Homo sapiens (human): 1960Help
Entry
1960              CDS       T01001                                 

Gene name
EGR3, EGR-3, PILOT
Definition
(RefSeq) early growth response 3
  KO
K12497  early growth response protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04625  C-type lectin receptor signaling pathway
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06162  Hepatitis B virus (HBV)
  Element
N00532  HBV HBx to Egr-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    1960 (EGR3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    1960 (EGR3)
  09172 Infectious disease: viral
   05161 Hepatitis B
    1960 (EGR3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    1960 (EGR3)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    1960 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-BED Zf_RING zf-H2C2_5 zf-C2H2_6
Motif
Other DBs
NCBI-GeneID: 1960
NCBI-ProteinID: NP_004421
OMIM: 602419
HGNC: 3240
Ensembl: ENSG00000179388
Vega: OTTHUMG00000097825
Pharos: Q06889(Tbio)
UniProt: Q06889
LinkDB All DBs
Position
8p21.3
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVVHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCGDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctccggcagcagc
gactcggtagtccattacaatcagatggctacagagaatgtaatggacatcggtctgacc
aacgagaagcccaacccggaactctcttactccggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgccaggac
aacatcattagcctcatgagcgccggcatcttgggggtgcccccggcttcaggggcgctc
agcacgcagacgtccacggccagcatggtgcagccaccgcagggtgacgtggaggccatg
tatcccgcgctacccccctactccaactgcggcgacctctactcagagcccgtgtctttc
cacgacccccagggcaatcccgggctcgcctattccccccaggattaccaatcggccaag
ccggcgttggacagcaatctcttccccatgattcctgactacaacctctaccaccacccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aacccgccccctattacccctctggagaccatcaaggcattcaaagacaagcagatccac
ccgggctttggcagcctgccccagccgccgctcaccctcaagcccatccggccccgcaag
taccccaaccggcctagcaagacaccgctccacgaacggccccacgcgtgcccggccgag
ggctgcgaccgccgtttcagccgttcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccagtgccggatctgcatgcggagcttcagccgcagcgaccacctc
accactcacatccgcactcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaaggcggagaagggcggtgcaccctctgcatcctcggcgccccccgtgtcgctggcc
cccgtggtcaccacctgcgcctga

DBGET integrated database retrieval system