KEGG   Homo sapiens (human): 196385
Entry
196385            CDS       T01001                                 

Gene name
DNAH10
Definition
(RefSeq) dynein axonemal heavy chain 10
  KO
K10408  dynein heavy chain, axonemal
Organism
hsa  Homo sapiens (human)
Pathway
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05022  Pathways of neurodegeneration - multiple diseases
Network
nt06419  Microtubule-based transport
nt06461  Huntington disease
nt06463  Parkinson disease
nt06464  Amyotrophic lateral sclerosis
  Element
N00976  Retrograde axonal transport
N00977  Mutation-caused aberrant Htt to retrograde axonal transport
N01159  Mutation-caused aberrant TUBA4A to retrograde axonal transport
N01160  Mutation-caused aberrant SOD1 to retrograde axonal transport
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    196385 (DNAH10)
   05016 Huntington disease
    196385 (DNAH10)
   05022 Pathways of neurodegeneration - multiple diseases
    196385 (DNAH10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    196385 (DNAH10)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Dyneins
     196385 (DNAH10)
SSDB
Motif
Pfam: AAA_6 DHC_N1 DHC_N2 AAA_8 Dynein_C AAA_9 AAA_7 AAA_lid_11 MT Dynein_heavy Dynein_AAA_lid AAA_5 AAA_lid_1 AAA_22 AAA RsgA_GTPase AAA_18 Spo7_2_N
Other DBs
NCBI-GeneID: 196385
NCBI-ProteinID: NP_997320
OMIM: 605884
HGNC: 2941
Ensembl: ENSG00000197653
Vega: OTTHUMG00000154477
Pharos: Q8IVF4(Tdark)
UniProt: Q8IVF4 B0I1S1
LinkDB
Position
12q24.31
AA seq 4471 aa
MVPEEVEVEIDEIPVLSEEGEEEEETYSQKVESVDKVRAKRVSLRTESLGQPLNREDEEM
DKEISEKLPSKRTAKHIMEKMHLHMLCTPLPEEFLDQNVVFFLRNTKEAISEATDMKEAM
EIMPETLEYGIINANVLHFLKNIICQVFLPALSFNQHRTSTTVGVTSGEVSNSSEHESDL
PPMPGEAVEYHSIQLIRDEFLMNVQKFASNIQRTMQQLEGEIKLEMPIISVEGEVSDLAA
DPETVDILEQCVINWLNQISTAVEAQLKKTPQGKGPLAEIEFWRERNATLSALHEQTKLP
IVRKVLDVIKESDSMLVANLQPVFTELFKFHTEASDNVRFLSTVERYFKNITHGSGFHVV
LDTIPAMMSALRMVWIISRHYNKDERMIPLMERIAWEIAERVCRVVNLRTLFKENRASAQ
SKTLEARNTLRLWKKAYFDTRAKIEASGREDRWEFDRKRLFERTDYMATICQDLSDVLQI
LEEFYNIFGPELKAVTGDPKRIDDVLCRVDGLVTPMENLTFDPFSIKSSQFWKYVMDEFK
IEVLIDIINKIFVQNLENPPLYKNHPPVAGAIYWERSLFFRIKHTILRFQEVQEILDSDR
GQEVKQKYLEVGRTMKEYEDRKYEQWMEVTEQVLPALMKKSLLTKSSIATEEPSTLERGA
VFAINFSPALREIINETKYLEQLGFTVPELARNVALQEDKFLRYTAGIQRMLDHYHMLIG
TLNDAESVLLKDHSQELLRVFRSGYKRLNWNSLGIGDYITGCKQAIGKFESLVHQIHKNA
DDISSRLTLIEAINLFKYPAAKSEEELPGVKEFFEHIERERASDVDHMVRWYLAIGPLLT
KVEGLVVHTNTGKAPKLASYYKYWEKKIYEVLTKLILKNLQSFNSLILGNVPLFHTETIL
TAPEIILHPNTNEIDKMCFHCVRNCVEITKHFVRWMNGSCIECPPQKGEEEEVVIINFYN
DISLNPQIIEQAVMIPQNVHRILINLMKYLQKWKRYRPLWKLDKAIVMEKFAAKKPPCVA
YDEKLQFYSKIAYEVMRHPLIKDEHCIRLQLRHLANTVQENAKSWVISLGKLLNESAKEE
LYNLHEEMEHLAKNLRKIPNTLEDLKFVLATIAEIRSKSLVMELRYRDVQERYRTMAMYN
LFPPDAEKELVDKIESIWSNLFNDSVNVEHALGDIKRTFTELTRGEIMNYRVQIEEFAKR
FYSEGPGSVGDDLDKGVELLGVYERELARHEKSRQELANAEKLFDLPITMYPELLKVQKE
MSGLRMIYELYEGLKVAKEEWSQTLWINLNVQILQEGIEGFLRALRKLPRPVRGLSVTYY
LEAKMKAFKDSIPLLLDLKNEALRDRHWKELMEKTSVFFEMTETFTLENMFAMELHKHTD
VLNEIVTAAIKEVAIEKAVKEILDTWENMKFTVVKYCKGTQERGYILGSVDEIIQSLDDN
TFNLQSISGSRFVGPFLQTVHKWEKTLSLIGEVIEIWMLVQRKWMYLESIFIGGDIRSQL
PEEAKKFDNIDKVFKRIMGETLKDPVIKRCCEAPNRLSDLQNVSEGLEKCQKSLNDYLDS
KRNAFPRFFFISDDELLSILGSSDPLCVQEHMIKMYDNIASLRFNDGDSGEKLVSAMISA
EGEVMEFRKILRAEGRVEDWMTAVLNEMRRTNRLITKEAIFRYCEDRSRVDWMLLYQGMV
VLAASQVWWTWEVEDVFHKAQKGEKQAMKNYGRKMHRQIDELVTRITMPLSKNDRKKYNT
VLIIDVHARDIVDSFIRGSILEAREFDWESQLRFYWDREPDELNIRQCTGTFGYGYEYMG
LNGRLVITPLTDRIYLTLTQALSMYLGGAPAGPAGTGKTETTKDLAKALGLLCVVTNCGE
GMDYRAVGKIFSGLAQCGAWGCFDEFNRIDASVLSVISSQIQTIRNALIHQLTTFQFEGQ
EISLDSRMGIFITMNPGYAGRTELPESVKALFRPVVVIVPDLQQICEIMLFSEGFLEAKT
LAKKMTVLYKLAREQLSKQYHYDFGLRALKSVLVMAGELKRGSSDLREDVVLMRALRDMN
LPKFVFEDVPLFLGLISDLFPGLDCPRVRYPDFNDAVEQVLEENGYAVLPIQVDKVVQMF
ETMLTRHTTMVVGPTRGGKSVVINTLCQAQTKLGLTTKLYILNPKAVSVIELYGILDPTT
RDWTDGVLSNIFREINKPTDKKERKYILFDGDVDALWVENMNSVMDDNRLLTLANGERIR
LQAHCALLFEVGDLQYASPATVSRCGMVYVDPKNLKYRPYWKKWVNQIPNKVEQYNLNSL
FEKYVPYLMDVIVEGIVDGRQAEKLKTIVPQTDLNMVTQLAKMLDALLEGEIEDLDLLEC
YFLEALYCSLGASLLEDGRMKFDEYIKRLASLSTVDTEGVWANPGELPGQLPTLYDFHFD
NKRNQWVPWSKLVPEYIHAPERKFINILVHTVDTTRTTWILEQMVKIKQPVIFVGESGTS
KTATTQNFLKNLSEETNIVLMVNFSSRTTSMDIQRNLEANVEKRTKDTYGPPMGKRLLVF
MDDMNMPRVDEYGTQQPIALLKLLLEKGYLYDRGKELNCKSIRDLGFIAAMGKAGGGRNE
VDPRFISLFSVFNVPFPSEESLHLIYSSILKGHTSTFHESIVAVSGKLTFCTLALYKNIV
QDLPPTPSKFHYIFNLRDLSRVFNGLVLTNPERFQTVAQMVRVWRNECLRVFHDRLISET
DKQLVQQHIGSLVVEHFKDDVEVVMRDPILFGDFQMALHEGEPRIYEDIQDYEAAKALFQ
EILEEYNESNTKMNLVLFDDALEHLTRVHRIIRMDRGHALLVGVGGSGKQSLSRLAAFTA
SCEVFEILLSRGYSENSFREDLKSLYLKLGIENKAMIFLFTDAHVAEEGFLELINNMLTS
GIVPALFSEEEKESILSQIGQEALKQGMGPAKESVWQYFVNKSANNLHIVLGMSPVGDTL
RTWCRNFPGMVNNTGIDWFMPWPPQALHAVAKSFLGYNPMIPAENIENVVKHVVLVHQSV
DHYSQQFLQKLRRSNYVTPKNYLDFINTYSKLLDEKTQCNIAQCKRLDGGLDKLKEATIQ
LDELNQKLAEQKIVLAEKSAACEALLEEIAVNTAVAEEKKKLAEEKAMEIEEQNKVIAME
KAEAETTLAEVMPILEAAKLELQKLDKSDVTEIRSFAKPPKQVQTVCECILIMKGYKELN
WKTAKGVMSDPNFLRSLMEIDFDSITQSQVKNIKGLLKTLNTTTEEMEAVSKAGLGMLKF
VEAVMGYCDVFREIKPKREKVARLERNFYLTKRELERIQNELAAIQKELETLGAKYEAAI
LEKQKLQEEAEIMERRLIAADKLISGLGSENIRWLNDLDELMHRRVKLLGDCLLCAAFLS
YEGAFTWEFRDEMVNRIWQNDILEREIPLSQPFRLESLLTDDVEISRWGSQGLPPDELSV
QNGILTTRASRFPLCIDPQQQALNWIKRKEEKNNLRVASFNDPDFLKQLEMSIKYGTPFL
FRDVDEYIDPVIDNVLEKNIKVSQGRQFIILGDKEVDYDSNFRLYLNTKLANPRYSPSVF
GKAMVINYTVTLKGLEDQLLSVLVAYERRELEEQREHLIQETSENKNLLKDLEDSLLREL
ATSTGNMLDNVDLVHTLEETKSKATEVSEKLKLAEKTALDIDRLRDGYRPAARRGAILFF
VLSEMALVNSMYQYSLIAFLEVFRLSLKKSLPDSILMKRLRNIMDTLTFSIYNHGCTGLF
ERHKLLFSFNMTIKIEQAEGRVPQEELDFFLKGNISLEKSKRKKPCAWLSDQGWEDIILL
SEMFSDNFGQLPDDVENNQTVWQEWYDLDSLEQFPVPLGYDNNITPFQKLLILRCFRVDR
VYRAVTDYVTVTMGEKYVQPPMISFEAIFEQSTPHSPIVFILSPGSDPATDLMKLAERSG
FGGNRLKFLAMGQGQEKVALQLLETAVARGQWLMLQNCHLLVKWLKDLEKSLERITKPHP
DFRLWLTTDPTKGFPIGILQKSLKVVTEPPNGLKLNMRATYFKISHEMLDQCPHPAFKPL
VYVLAFFHAVVQERRKFGKIGWNVYYDFNESDFQVCMEILNTYLTKAFQQRDPRIPWGSL
KYLIGEVMYGGRAIDSFDRRILTIYMDEYLGDFIFDTFQPFHFFRNKEVDYKIPVGDEKE
KFVEAIEALPLANTPEVFGLHPNAEIGYYTQAARDMWAHLLELQPQTGESSSGISRDDYI
GQVAKEIENKMPKVFDLDQVRKRLGTGLSPTSVVLLQELERFNKLVVRMTKSLAELQRAL
AGEVGMSNELDDVARSLFIGHIPNIWRRLAPDTLKSLGNWMVYFLRRFSQYMLWVTESEP
SVMWLSGLHIPESYLTALVQATCRKNGWPLDRSTLFTQVTKFQDADEVNERAGQGCFVSG
LYLEGADWDIEKGCLIKSKPKVLVVDLPILKIIPIEAHRLKLQNTFRTPVYTTSMRRNAM
GVGLVFEADLFTTRHISHWVLQGVCLTLNSD
NT seq 13416 nt   +upstreamnt  +downstreamnt
atggtgccggaggaggtggaggtggagattgatgagatacctgtcctgtctgaagaggga
gaagaggaagaagagacttattctcaaaaagtggagtccgtggataaagtgcgagctaag
cgtgtgtcactgagaaccgaatctctaggccaacctctaaacagagaggatgaagaaatg
gacaaagagatttcagaaaaactcccttccaaaagaactgcgaagcacatcatggaaaag
atgcatctccacatgctctgtacccctcttcccgaggagttcctggaccaaaacgtggtg
tttttcctcagaaataccaaagaggcaatctctgaagctaccgacatgaaggaagctatg
gaaattatgccagaaacactggagtatggaattataaacgctaatgtgctccattttctg
aagaatattatatgtcaggtttttttgccagcattgtccttcaatcagcacaggacgagt
acaaccgtgggagtcacatctggagaagtctctaattcctctgagcatgaatcagacctg
ccgcccatgcctggggaggcagtagaatatcacagtattcaattaatacgggatgaattt
ttaatgaacgtgcagaaatttgcaagtaatattcaaagaaccatgcagcaacttgaaggt
gagatcaagttagaaatgccaatcatcagtgtggagggagaggtgtctgacctggcagct
gacccggaaaccgttgacatcttggagcagtgtgtgataaactggctgaatcagatatcc
acagcggttgaggcccaactgaagaagacacctcagggtaaaggccctctggctgaaatt
gaattctggagggaaagaaatgcaaccttaagtgcgctgcatgaacaaacaaagcttcca
atagtcagaaaagtcttggatgtgatcaaggaatccgactccatgcttgtggctaatctg
cagccagtgttcaccgagttattcaagttccacacggaggcctcagacaatgtgcgcttt
ctctccaccgtggagcgttatttcaagaacataacgcacgggtctggcttccacgtggtc
ctggacaccatccccgccatgatgagtgccctgcggatggtgtggatcatctcccgacac
tacaacaaagacgagaggatgattccgctcatggagcgcatcgcctgggaaatcgctgag
agagtctgccgagtggtcaacctgcggactttgttcaaagaaaatcgagcgagtgcccaa
agcaaaaccttggaagccaggaacaccctcaggctgtggaaaaaggcctattttgacacc
cgggccaagatagaggcttcggggagggaagatcggtgggagtttgaccggaagcggctg
ttcgagaggacggattatatggccaccatctgccaggacctctccgacgttctgcagatt
ttggaggaattttataacatatttggtccagaactaaaggcagtgacgggggaccccaag
cgcattgatgatgtcctatgcagagtggacggcctagtcacccccatggaaaacctgacc
tttgaccccttcagcatcaagtcctcccagttctggaaatatgtgatggatgaattcaag
attgaagttctgattgacatcattaataaaatctttgtccagaaccttgaaaatccacca
ctgtataagaatcaccctccagtagcaggtgcaatatactgggaacgatctctgttcttt
cggattaagcataccatcctccgatttcaagaggtacaagagatactggacagtgatcga
ggacaggaggtcaaacaaaaatatttggaagtaggtaggacaatgaaggagtatgaagac
agaaagtatgagcagtggatggaggtgacggagcaggtgctgccagctctcatgaagaag
agccttttgaccaagtcttccatcgccacagaggagccttcgactttagaaaggggagct
gtttttgcaatcaacttttcaccggctctcagagagattattaatgaaacaaagtactta
gagcagctggggttcactgtccctgaattagcaagaaatgttgctctccaggaagacaaa
ttccttaggtacacagctgggatacagcgcatgttggatcattatcacatgctcatagga
acgttaaacgatgcggagtctgtgcttctcaaagatcattcccaggaactgctccgagtg
tttaggtcgggatataagaggttgaactggaactcactaggtatcggtgactatataact
ggttgcaaacaggccattgggaaatttgagtctctcgtccaccagattcataagaatgca
gatgacatttcttccaggctgacattaatagaggccataaatctctttaaatatccagcc
gctaaaagtgaggaagaactcccaggcgtgaaggaattttttgaacacattgagcgagaa
agggccagcgacgtggaccacatggtccggtggtatcttgccattggaccactgctgacc
aaagttgagggcctggtcgtccacaccaacacaggcaaggcccccaagctggcctcctac
tacaaatactgggaaaagaaaatttatgaggtcctgacaaagctcatcctgaagaacttg
cagtcttttaattctttgatccttggaaatgtccctctgttccacactgaaaccattctg
acggcacctgagatcatccttcatcccaacacaaatgagatcgacaagatgtgcttccat
tgtgtccggaattgcgtggagatcaccaagcattttgttcgttggatgaatggcagctgc
atagaatgcccacctcagaagggggaggaagaggaagttgttataataaacttttacaat
gatatctctctgaaccctcagataattgaacaagctgttatgatcccccaaaatgtccac
aggattctgatcaatcttatgaagtatctacaaaaatggaagcggtatcgacctctctgg
aaattggacaaagctattgtgatggagaaatttgctgccaagaaacctccttgtgtagca
tatgatgaaaagttgcagttctattccaagatagcttatgaggttatgcgccaccctcta
attaaggatgagcattgcatcagacttcagctcaggcatctggcaaacacagtgcaggaa
aatgccaagtcctgggtgatttcgcttggaaaacttctcaatgagtcagcaaaagaggag
ctctataatctccatgaagagatggagcacctggccaaaaaccttaggaagatccccaat
acccttgaagatctcaagtttgtccttgcaacaattgcagaaattagaagtaaatctcta
gtcatggaactcagatatagggacgtccaggagcgataccgtaccatggcaatgtataac
ctctttcctcctgatgcagagaaagaactggttgataagattgagagcatatggtccaat
ctgtttaatgattcagtgaatgtggagcatgctcttggggacataaagagaactttcaca
gagcttactcgaggcgaaataatgaactacagagttcagatagaggagtttgcaaagcgt
ttttacagtgaaggccctggttctgttggtgatgatcttgataaaggagtagagctttta
ggtgtttatgaaagagagctggcaagacatgaaaagagccgtcaggaactggctaacgct
gagaaacttttcgatcttcctattacaatgtacccagagctgctgaaagtgcagaaggaa
atgagtgggctgaggatgatttacgagctctatgaaggactaaaggttgcaaaagaagaa
tggtctcagaccctttggatcaacctgaatgtgcagattctccaggaaggaattgaaggt
tttctcagggctctcagaaagctacctcggccagtccgtggcttatcagtgacctactac
ttggaagcaaaaatgaaggcattcaaagactcgattcctttacttcttgacttgaaaaac
gaggcactaagagacaggcattggaaagaacttatggaaaaaacgtctgtcttttttgaa
atgaccgaaacgttcaccttggaaaatatgtttgctatggaactgcacaaacacacagat
gttctcaatgagattgtcacagcagcaatcaaggaggttgccattgagaaggctgtgaag
gaaatcctagacacgtgggaaaatatgaaattcactgtagtcaagtattgcaaaggcaca
caggagcgaggctacatcctgggttctgttgacgaaattattcagtctcttgatgacaac
actttcaacctgcagagcatctcaggaagcagatttgtggggccttttctgcaaactgtt
cacaaatgggaaaaaacgctttctctaataggggaagtcattgagatttggatgttggtt
cagagaaaatggatgtatcttgaaagtatttttattggtggagatataagatcacaactt
ccggaagaggcaaaaaagtttgacaacatcgataaagtatttaaaaggatcatgggtgag
accttaaaagaccccgtgatcaagaggtgctgtgaagccccaaaccgcctcagtgaccta
cagaacgtcagcgagggcctggagaaatgccagaaaagcctcaacgactacttagattcg
aagagaaatgctttcccaaggttcttcttcatttctgacgatgagttgcttagcattctg
gggagcagcgacccactctgcgtccaggagcacatgatcaagatgtacgacaacatagca
tcactgaggtttaatgacggcgatagtggagaaaaactggtgtccgcgatgatttcagca
gaaggagaagtcatggagtttcggaagatcttgcgggctgaagggcgcgtggaggactgg
atgacggcagttttgaatgagatgagaagaactaatagactaattaccaaagaggctatt
tttagatactgtgaagacagaagcagagtcgactggatgctcctgtaccagggcatggtg
gtgctggccgctagccaggtgtggtggacctgggaggtggaagacgtcttccacaaagcg
caaaaaggggagaagcaggccatgaagaactatggcaggaaaatgcaccggcagatcgat
gagttggtaacgcgcatcaccatgccgctaagcaaaaacgacaggaaaaaatacaacact
gttctcatcattgatgtgcatgccagagacatagttgattctttcataagaggcagtatc
ctggaggcccgagagtttgactgggaaagtcagttgcggttttattgggaccgggagccg
gatgagctgaacatccgccagtgcacgggaacctttggctacggctacgagtacatgggc
ctgaacggcaggctggtcatcacgcccctcaccgatcggatttacctgacgctcacccag
gcgctgtccatgtatctaggtggggcccccgccggcccagcaggaaccggcaaaaccgag
accaccaaggacctggcgaaagccttgggcttgctctgtgttgtcaccaactgtggcgaa
ggcatggattacagggccgtggggaagattttctctggcctggcacagtgcggggcttgg
ggctgctttgatgagtttaatcgaatcgatgcttctgtgctctccgtgatctcctcccag
atccagacgatccgaaatgctctgatccatcagttaaccacgttccagtttgaagggcag
gagatttccctggactcccgcatgggcatcttcatcaccatgaaccccggctacgcaggc
cgcacggagctgcccgagtcggtgaaggcgctgttcaggcctgtggtcgtgatcgtgccc
gacctgcagcagatctgtgagatcatgctcttctctgagggcttcctggaggccaagact
ctggcgaaaaagatgacggttctgtataagctggcccgggagcagctgtccaagcagtat
cactatgattttggactcagagccctgaaatcggtgctggtcatggctggtgagctgaag
agaggctcctctgaccttagggaggacgtggtgctgatgagggccttgcgagacatgaac
ttgcccaaatttgtgtttgaagatgttcctcttttccttggtttgatttcggatctgttt
cctgggctggactgccctcgcgtccgctaccctgacttcaacgatgcggtagagcaggtc
ctggaggagaacggctacgcggtcctacccatccaggtggataaagtggttcaaatgttc
gagaccatgttaacccgccacacgacgatggtggtggggcccaccagagggggcaagtcc
gtcgtcattaacactctgtgtcaggcccagaccaagcttgggctgacgacaaagttgtac
atcctgaaccccaaagccgtgagtgtcatagaactctacggcatcctggacccaaccacc
cgagactggacagatggggtgttgtcaaacatcttcagggaaatcaacaagccaacagac
aagaaggagcgaaagtatattttatttgatggtgatgtggatgctctatgggtggaaaac
atgaattctgtgatggatgacaacaggttgttgacattggccaacggggaacgcatccgg
ctccaagcacactgtgccctgctctttgaggttggagatttacagtatgcctcccctgca
actgtctctcgatgtggaatggtttatgtggatcctaaaaacttgaaatatcgaccatac
tggaaaaaatgggttaatcaaataccaaacaaggtggagcaatacaatttgaatagtctc
tttgagaagtatgtgccctatctcatggatgtgatagtggaaggaattgtggatggaaga
caagcagaaaagctgaagacaatagttcctcagacagacctcaatatggtaacccagtta
gccaagatgttggatgcgttgctagaaggagaaatagaagaccttgacctgctggagtgc
tacttcctggaggctttgtactgctctctgggagcctccctgcttgaggatggaaggatg
aaatttgacgaatatatcaaacgccttgcttctttgtctactgttgacacagaaggagtt
tgggccaaccctggggaactgccaggtcaacttccaaccttgtatgactttcattttgat
aacaaacggaatcaatgggtcccatggagtaaattagttccagagtatattcatgccccc
gagaggaaattcatcaacatcctggttcacacagtggataccactcggactacctggata
ttggaacaaatggttaaaattaagcaacctgttatttttgttggtgaatctggcacttct
aagacagccactacccagaatttcctcaaaaatctgagtgaagaaactaacattgtgtta
atggtcaacttctcctcccgcaccacgtccatggatatccaaagaaatttagaagcaaat
gtggaaaagcgaaccaaagatacttacggcccacccatgggaaaacgcctgctggtgttc
atggatgacatgaatatgccaagggtggatgaatatggcacgcagcagcccattgccttg
ctgaagctgctgttggaaaaaggctacttatatgaccgtgggaaggagctgaactgtaaa
agcattcgagaccttggctttattgctgcaatgggaaaggctggaggaggccgcaatgaa
gttgacccaagatttatttcgctattcagtgtcttcaatgtgccatttccttcagaggag
tctctgcatttaatttattcctccatcctgaaaggccacacctcgacgtttcatgagagc
attgtggctgtgagtggcaagctgacattctgcacgctagcactttacaaaaatattgtg
caagacctacctcccactccgtcaaagttccattacatcttcaaccttcgagatctctca
cgggtttttaatggtcttgtcctcactaacccggagcgattccagacggtggcccagatg
gtgagagtctggaggaatgagtgtctgagagtcttccacgaccggctgatcagtgaaaca
gacaagcagctggtacaacagcacataggcagcttggttgtggaacattttaaagatgac
gtggaggtggtgatgagggatcccatattgtttggagacttccagatggctctgcacgaa
ggagaaccacgcatttatgaagacatccaggactacgaggcggccaaggctctgttccag
gaaattcttgaagagtataatgaaagcaacaccaaaatgaacttggttctcttcgacgat
gctctggagcatttaacccgggtgcaccgtatcatccgcatggaccgcggccacgccctg
ctggtcggggtagggggctcagggaagcagtctctttcgaggctggctgccttcacagcc
agctgtgaggtgtttgagatcctgctgagccgaggctactcggagaacagtttccgggaa
gacctgaagagcctctatttgaaacttgggattgagaacaaagcgatgatctttctgttc
acggatgcccatgtggctgaggagggcttcctggagctcatcaacaacatgctgacctca
ggaattgtacctgcgcttttttctgaagaggagaaagagtctatcctgagtcagattgga
caggaagctctgaagcaaggcatggggccggccaaggagtctgtgtggcagtacttcgtg
aacaaaagtgcaaataacctgcacattgtcctgggcatgtcgccagtgggggacaccctg
aggacctggtgcagaaacttcccaggtatggtaaataacactggtattgactggttcatg
ccctggcctccccaagccctccatgcggtcgcaaagtcctttctagggtataatccaatg
atcccggcagaaaatatagaaaatgtggtgaagcatgttgtcttggttcaccaatccgtg
gaccactacagccaacagtttctacagaaattgaggcgcagcaactatgtcactcccaag
aactaccttgattttattaacacctattcaaaattgctggatgagaaaactcagtgtaat
atagctcagtgcaagcgtctggatgggggactggacaagctgaaggaggccaccatccag
ctggacgagctgaaccagaagctggccgagcagaagatcgtgctggcggagaagtccgcc
gcctgcgaggccttgctggaggagatcgccgtcaacaccgctgtagccgaggagaagaag
aaactggcagaggaaaaggccatggagatagaggagcagaacaaagtcattgccatggag
aaggccgaggccgagacgaccctggcagaggtcatgcccatcctggaggccgccaagctg
gaactgcagaagctggacaagtcggacgtgactgagattaggtcgtttgctaagcccccg
aagcaggtgcagacggtctgcgaatgcatcctcatcatgaaagggtacaaagagctgaac
tggaaaacagccaagggcgtgatgtccgacccgaatttcctgcggtctctgatggagatt
gattttgattcgattacccagagccaagtgaaaaacatcaaaggcctcttgaagactctt
aataccacaactgaagaaatggaagctgtcagcaaagccgggctggggatgctgaaattt
gttgaagctgtaatgggctactgtgatgttttcagagaaatcaagcccaaaagagagaag
gtggccaggctggagcggaatttttacctcactaaacgggaactggaaaggatccagaat
gagttggcagcaattcagaaagagctggaaacattgggtgccaaatatgaggccgccata
ctggaaaagcagaagctgcaggaagaagccgagatcatggagaggcggctgattgccgca
gacaaactcatctcgggtctggggtcagaaaacatcaggtggctgaacgacctggatgag
ctgatgcaccggcgcgtgaagctgctgggggactgcctgctctgcgcggctttcctcagc
tacgagggagccttcacctgggagttccgtgacgagatggtcaatcggatttggcaaaat
gacatcctggagcgggagatccccctgagccagcctttccggctggaaagcctgctcacg
gatgatgttgagatcagcagatggggatcccagggccttccccccgatgagctctccgtt
cagaatggcatcctcaccacccgggccagccgcttccctctgtgtatcgacccccagcag
caggccctcaactggatcaagagaaaagaggagaagaacaatctgcgggtcgcttccttt
aatgaccctgacttcctcaagcagctagagatgtccataaagtacgggacccctttcctg
ttccgcgatgttgatgaatacatcgatcctgtgattgacaacgtcttagaaaaaaatata
aaagtctcccaaggacggcagtttattatcctgggagacaaggaagtggactatgattca
aatttcagactgtacctgaacaccaagctggccaatcccagatattccccatccgtgttt
gggaaagctatggtgatcaattacactgtcacgctgaagggcctggaggaccagctgctg
agcgtgctggtggcttacgagaggcgggagctggaggagcagcgggagcacctcatccag
gagaccagcgagaacaagaacctgctcaaggacctggaagattccctccttcgggagctg
gccacgtccacggggaacatgctggacaatgtggacctggtgcacaccctggaggagacc
aaatccaaggcaacagaggtctcagagaaactcaagctggcggagaagacagccttggac
atcgacaggctgcgggatggctaccggccagcagccaggaggggggccatcctgttcttc
gtcctgtctgagatggccctggtgaactccatgtaccagtactccctgattgccttctta
gaggtcttcaggctgtcactgaagaagtcgctgcctgattccatcctcatgaaacgcctg
aggaacatcatggacacgctgaccttcagcatctataaccacggctgcacagggctgttt
gagaggcacaagctactcttttcttttaatatgaccatcaagatagaacaagcagaaggg
agagtccctcaagaagaactagatttctttttaaaaggaaacatttccctggagaaaagc
aaaagaaaaaagccctgcgcttggttgtctgaccaaggatgggaagatatcattctttta
tcagaaatgttttcagacaactttgggcaacttcctgatgatgttgagaataatcagact
gtctggcaggagtggtatgacctggattcactggagcagtttcccgtccccttgggttac
gataacaacatcacccctttccagaagttgcttattttgcgctgtttccgtgtggatcgg
gtctatcgggccgtgactgactatgtgactgtaacaatgggagagaagtatgtgcagccc
ccaatgatcagctttgaagctatttttgagcagagcactccacattcgcccattgtgttt
atcctgagtcctggctccgaccctgccactgatcttatgaaattagcagagcgaagtggt
tttggaggaaatcgcctcaaattccttgcaatgggtcaaggtcaagaaaaggtggccctg
cagctgctggagacggcggtggctcgggggcagtggctgatgctgcagaactgccacctc
ctggtcaagtggctgaaagatctggagaagtccctggagaggatcaccaagccccaccca
gacttccgcctgtggctcaccacggaccccaccaagggcttccccattgggattctgcag
aagtccctaaaggttgtcaccgagccacccaatgggctgaaactcaacatgagggcaact
tacttcaagatctctcacgaaatgctggaccagtgcccgcaccctgccttcaagccgctg
gtctacgtgctggcgttctttcatgctgtggtgcaggagagaaggaagtttgggaagatt
ggctggaacgtgtactatgacttcaatgagtctgacttccaggtctgcatggaaattctg
aacacgtacttaacgaaagccttccagcaacgggacccaaggatcccgtggggcagcctc
aagtacctaattggagaggtcatgtatggaggacgggccatcgacagctttgatcgccgc
atcctgaccatctacatggatgagtacctgggggacttcatttttgatactttccagcca
ttccacttcttccggaacaaggaagtggactacaaaatccctgttggtgatgaaaaggag
aaatttgttgaagccatcgaggccctcccgcttgccaacacgccagaagtgtttggtctc
caccccaacgctgagattggctattacacgcaggcggctcgagacatgtgggctcacctg
ctggagctgcagcctcagacaggggaatccagcagtggtatcagccgcgatgattatatt
ggccaagtggccaaagaaatagaaaacaagatgcccaaagtctttgacttggaccaggtg
aggaagcgcctcggaacaggactctcccccacttcggtggtgctcctgcaggaactggaa
cgcttcaacaagcttgtggtccggatgacgaagtctctggctgaacttcaaagggccttg
gctggagaagttggaatgagcaatgagttagatgatgtggccaggtctctttttatcggg
catatccctaatatctggagaaggcttgctcctgacaccttaaagtcccttggaaactgg
atggtctacttcctgcggcggttcagccagtacatgttgtgggtgaccgagagcgagccc
agcgtgatgtggctctcggggctgcacatccctgagtcctacctcacggcgctggtgcag
gccacctgccggaagaacggctggccactggaccgctccaccttgttcacacaagtgacc
aagttccaggatgcagatgaagtgaatgagcgggcgggacaaggatgctttgtctcagga
ctgtacctggaaggtgctgactgggatatagaaaaaggatgtcttatcaagagcaaaccc
aaggtgctggttgtggacctgccgatcctgaagatcatccccattgaagcccatcgcctc
aagctgcagaatactttccggacccccgtctacaccacctccatgagaaggaacgccatg
ggagtcggcttggtttttgaagctgatctctttaccacgaggcacatttctcactgggtg
ctgcaaggagtatgcctcaccctgaattctgattaa

DBGET integrated database retrieval system