KEGG   Homo sapiens (human): 1967Help
Entry
1967              CDS       T01001                                 

Gene name
EIF2B1, EIF2B, EIF2BA
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit alpha
  KO
K03239  translation initiation factor eIF-2B subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1967 (EIF2B1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    1967 (EIF2B1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    1967 (EIF2B1)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    1967 (EIF2B1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B
Motif
Other DBs
NCBI-GeneID: 1967
NCBI-ProteinID: NP_001405
OMIM: 606686
HGNC: 3257
Ensembl: ENSG00000111361
Vega: OTTHUMG00000168696
Pharos: Q14232(Tbio)
UniProt: Q14232
LinkDB All DBs
Structure
PDB: 

Position
12q24.31
AA seq 305 aa AA seqDB search
MDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKGETIQGLRANLTSAIETLCGVD
SSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGELFLRRISLSRNKIADLCHTFIK
DGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDLSGKKMAKALCHLNVPVTVVLD
AAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCAKAQNKPFYVVAESFKFVRLFP
LNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPSLITLLFTDLGVLTPSAVSDEL
IKLYL
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
atggacgacaaggagttaattgaatactttaagtctcagatgaaagaagatcctgacatg
gcctcagcagtggctgccatccggacgttgctggagttcttgaagagagataaaggggag
acaatccagggtctgagggcgaatctcaccagtgccatagaaaccctgtgtggtgtggac
tcctctgtggcagtgtcctctggcggggagctcttcctccgcttcatcagtcttgcctcc
ctggaatactccgattactccaaatgtaaaaagatcatgattgagcggggagaacttttt
ctcaggagaatatcactgtcaagaaacaaaattgcagatctgtgccatactttcatcaaa
gatggagcgacaatattgactcacgcctactccagagtggtcctgagagtcctggaagca
gccgtggcggccaagaagcgatttagtgtatacgtcacagagtcacagcctgatttgtca
ggtaagaaaatggccaaagccctctgccacctcaacgtccctgtcactgtggtgctagat
gctgctgtcggctacatcatggagaaagcagatcttgtcatagttggtgctgaaggagtt
gttgaaaacggaggaattattaacaagattggaaccaaccagatggctgtgtgtgccaaa
gcacagaacaaacctttctatgtggttgcagaaagtttcaagtttgtccggctctttcca
ctaaaccagcaagacgtcccagataagtttaagtataaggcagacactctcaaggtcgcg
cagactggacaagacctcaaagaggagcatccgtgggtcgactacactgccccttcctta
atcactctgctgtttacagacctgggcgtgctgacaccctcagcagtcagcgatgagctc
atcaagctctatctgtaa

KEGG   Homo sapiens (human): 8890Help
Entry
8890              CDS       T01001                                 

Gene name
EIF2B4, EIF-2B, EIF2B, EIF2Bdelta
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit delta
  KO
K03680  translation initiation factor eIF-2B subunit delta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8890 (EIF2B4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8890 (EIF2B4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8890 (EIF2B4)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8890 (EIF2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B DUF3819
Motif
Other DBs
NCBI-GeneID: 8890
NCBI-ProteinID: NP_001029288
OMIM: 606687
HGNC: 3260
Ensembl: ENSG00000115211
Vega: OTTHUMG00000151927
Pharos: Q9UI10(Tbio)
UniProt: Q9UI10
LinkDB All DBs
Structure
PDB: 

Position
2p23.3
AA seq 523 aa AA seqDB search
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgtggccgtggctgttcgcgaggactcgggatccgggatgaaggcggagctt
ccccctgggcctggggcagtggggagggaaatgaccaaagaagaaaagctgcagcttcgg
aaggaaaagaaacagcagaagaagaaacggaaggaagaaaagggggcagaaccagagact
ggctctgctgtatctgcagcccaatgtcaagtaggcccaaccagagaactgccagaatcg
ggcattcagttgggcactcctcgggagaaagttccagctggtcggagtaaggccgaactt
cgggctgagcgtcgagccaagcaggaggccgagcgggccctgaaacaggcaagaaaaggg
gaacaaggaggaccacctcctaaggccagccccagcacagctggagaaaccccctcagga
gtgaagcgtctccctgagtaccctcaggttgatgacctacttctgagaaggcttgttaaa
aaaccagagcgtcaacaggttcctacacgaaaggattatggatccaaagtcagtctcttc
tctcacctaccccagtacagcagacaaaactctctgacccagtttatgagcatcccatcc
tctgtgatccacccagccatggtgcgactcggcctgcagtactcccagggcctggtcagt
ggctccaatgcccggtgtattgccctgcttcgtgccttgcagcaggtgattcaggattac
acaacaccgcctaatgaagaactctccagggatctagtgaataaactaaaaccctacatg
agcttcctgactcagtgccgtcccctgtcagcgagcatgcacaacgccatcaagttcctt
aacaaggaaatcaccagtgtgggcagttccaagcgggaagaggaggccaagtcagaactt
cgagcagccattgatcggtatgtgcaagagaagattgtgctagcagctcaggcaatttca
cgctttgcttaccagaagatcagtaatggagatgtgatcctggtatatggatgctcatct
ctggtatcacgaattcttcaggaggcttggacagagggccggcggtttcgggtggtagtg
gtggacagccggccatggctggaaggaaggcacacactacgttctctagtccatgctggt
gtcccagcctcctacctgctgattcctgcagcctcctatgtgctcccagaggtttccaag
gtgctattgggagctcatgcactcttggccaacgggtctgtgatgtcacgggtagggaca
gcacagttagccctggtggctcgagcccataatgtaccagtgctggtttgctgtgaaaca
tacaagttctgtgagcgtgtgcagactgatgcctttgtctctaatgagctagatgaccct
gatgatctgcaatgtaagcggggagaacatgttgcgctggctaactggcagaaccacgca
tccctacggttgttgaatctagtctatgatgtgactcccccagagcttgtggatctggtg
atcacggagctggggatgatcccttgcagttctgtacctgttgttctacgagtcaagagc
agtgaccagtga

KEGG   Homo sapiens (human): 8891Help
Entry
8891              CDS       T01001                                 

Gene name
EIF2B3, EIF-2B, EIF2Bgamma
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit gamma
  KO
K03241  translation initiation factor eIF-2B subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8891 (EIF2B3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8891 (EIF2B3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8891 (EIF2B3)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8891 (EIF2B3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 DUF4954 Hexapep CTP_transf_3 Fucokinase
Motif
Other DBs
NCBI-GeneID: 8891
NCBI-ProteinID: NP_065098
OMIM: 606273
HGNC: 3259
Ensembl: ENSG00000070785
Vega: OTTHUMG00000008585
Pharos: Q9NR50(Tbio)
UniProt: Q9NR50 Q9HA31
LinkDB All DBs
Structure
PDB: 

Position
1p34.1
AA seq 452 aa AA seqDB search
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggaatttcaagcagtagtgatggcagtaggtggaggatctcggatgacagacctaact
tccagcattcccaaacctctgcttccagttgggaacaaacctttaatttggtacccattg
aacctgcttgagcgtgttggatttgaagaagtcattgtggttacaaccagggatgttcaa
aaggctctatgtgcagaattcaagatgaaaatgaagccagatattgtgtgtattcctgat
gacgctgacatgggaactgcagattctttgcgctacatatatccaaaacttaagacagat
gtgctggtgctgagctgtgatctgataacagacgttgccttacatgaggttgtggacctg
tttagagcttatgatgcatcacttgctatgttgatgagaaaaggccaagatagcatagaa
cctgttcccggtcaaaaggggaaaaaaaaagcagtggagcagcgtgacttcattggagtg
gacagcacaggaaagaggctgctcttcatggctaatgaagcagacttggatgaagagctg
gtcattaagggatccatcctacagaagcatcctagaatacgtttccacacgggtcttgtg
gatgcccacctctactgtttgaaaaaatacatcgtggatttcctaatggaaaatgggtca
ataacttctatccggagtgaactgattccatatttagtgagaaaacagttttcctcagct
tcctcacaacagggacaagaagaaaaagaggaggatctaaagaaaaaggagctgaagtcc
ttagatatctacagttttataaaagaagccaatacactgaacctggctccctatgatgcc
tgctggaatgcctgtcgaggagacaggtgggaagacttgtccagatcacaggtgcgctgc
tatgtccacatcatgaaagaggggctctgctctcgagtgagcacactgggactctacatg
gaagcaaacagacaggtgcccaaattgctgtctgctctctgtccagaagaaccaccagtc
cattcgtcagcccagattgtcagcaaacacctggttggagttgacagcctcattgggcca
gagacacagattggagagaagtcatccattaagcgctcagtcattggctcatcctgtctc
ataaaagatagagtgactattaccaattgccttctcatgaactcagtcactgtggaggaa
ggaagcaatatccaaggcagtgtcatctgcaacaatgctgtgatcgagaagggtgcagac
atcaaggactgcttgattggaagtggccagaggattgaagccaaagctaaacgagtgaat
gaggtgatcgtggggaatgaccagctcatggagatctga

KEGG   Homo sapiens (human): 8892Help
Entry
8892              CDS       T01001                                 

Gene name
EIF2B2, EIF-2Bbeta, EIF2B
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit beta
  KO
K03754  translation initiation factor eIF-2B subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8892 (EIF2B2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8892 (EIF2B2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8892 (EIF2B2)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8892 (EIF2B2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF-2B DUF4055 MSC
Motif
Other DBs
NCBI-GeneID: 8892
NCBI-ProteinID: NP_055054
OMIM: 606454
HGNC: 3258
Ensembl: ENSG00000119718
Vega: OTTHUMG00000171764
Pharos: P49770(Tbio)
UniProt: P49770 Q53XC2
LinkDB All DBs
Structure
PDB: 

Position
14q24.3
AA seq 351 aa AA seqDB search
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgccgggatccgcagcgaagggctcggagttgtcagagaggatcgagagcttcgtggag
accctgaagcggggtggtgggccgcgcagctccgaggaaatggctcgggagaccctaggg
ttgctgcgccagatcatcacggaccaccgctggagcaacgcgggggagctgatggagctg
atccgcagagagggcaggaggatgacggccgctcagccctccgagaccaccgtgggcaac
atggtgcggagagtgctcaagattatccgggaggagtatggcagactccatggacgcagc
gacgagagtgatcagcaggagtccctgcacaaactgttgacatccggaggcctaaacgag
gatttcagcttccattatgcccaactccagtccaacatcattgaggcgattaatgagctg
ctagtggagctggaagggacaatggagaacattgcagcccaggctctggagcacattcac
tccaatgaggtgatcatgaccattggcttctcccgaacagtagaggccttcctcaaagag
gctgcccgaaagaggaaattccatgtcattgtagcagagtgtgctcctttctgccagggt
catgaaatggctgtgaatttgtccaaagcaggtattgagacaactgtcatgactgatgct
gccatttttgccgttatgtcaagagtcaacaaggtgatcattggcacgaagaccatcctg
gccaatggggccctgagagctgtgacaggaactcacactctggcactggcagcaaaacac
cattccaccccactcatcgtctgtgcacctatgttcaaactttctccacagttccccaat
gaagaagactcatttcataagtttgtggctcctgaagaagtcctgccattcacagaaggg
gacattctggagaaggtcagcgtgcattgccctgtgtttgactacgttcccccagagctc
attaccctctttatctccaacattggtgggaatgcaccttcctacatctaccgcctgatg
agtgaactctaccatcctgatgatcatgttttatga

KEGG   Homo sapiens (human): 8893Help
Entry
8893              CDS       T01001                                 

Gene name
EIF2B5, CACH, CLE, EIF-2B, EIF2Bepsilon, LVWM
Definition
(RefSeq) eukaryotic translation initiation factor 2B subunit epsilon
  KO
K03240  translation initiation factor eIF-2B subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa05168  Herpes simplex virus 1 infection
Network
nt06138  PKR-eIF2alpha signaling (viruses)
nt06168  Herpes simplex virus 1 (HSV-1)
nt06169  Measles virus (MV)
nt06170  Influenza A virus (IAV)
  Element
N00571  PKR-eIF2alpha signaling pathway
N00572  HSV ICP34.5 to PKR-eIF2alpha signaling pathway
N00573  HSV US11 to PKR-eIF2alpha signaling pathway
Disease
H00869  Leukoencephalopathy with vanishing white matter
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    8893 (EIF2B5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    8893 (EIF2B5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:hsa03012]
    8893 (EIF2B5)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-2B
    8893 (EIF2B5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: W2 Hexapep DUF4954 Fucokinase Hexapep_2
Motif
Other DBs
NCBI-GeneID: 8893
NCBI-ProteinID: NP_003898
OMIM: 603945
HGNC: 3261
Ensembl: ENSG00000145191
Vega: OTTHUMG00000156840
Pharos: Q13144(Tbio)
UniProt: Q13144
LinkDB All DBs
Structure
PDB: 

Position
3q27.1
AA seq 721 aa AA seqDB search
MAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEPPPPLQAVLVADSFDRRFFPIS
KDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKAAQIKEHLLKSKWCRPTSLNVV
RIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNINITRALEEHRLRRKLEKNVSV
MTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQGLRRFAFPLSLFQGSSDGVEV
RYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVNEEILGNQIHMHVTAKEYGARV
SNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSRHNIYRGPEVSLGHGSILEENV
LLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQGVRVAAGAQIHQSLLCDNAEVK
ERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEEDEDDGEFSDDSGADQEKDKVKM
KGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKINMEEESESESEQSMDSEEPDS
RGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEINSLKYAYNISLKEVMQVLSHVV
LEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALG
ISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED
D
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atggcggcccctgtagtggcgccgcctggtgtggtggttagtcgggctaacaagcgcagc
ggcgcggggccgggaggcagcggtggcgggggagccagaggggcggaggaggaaccgccg
ccgcccctacaagcagttctggtggccgatagcttcgatcgccgcttcttccccatctcc
aaggaccagcctcgggtcctcttgcccctggccaatgtggcattaattgactacactctg
gaattcctgactgccacaggtgtacaggaaacatttgtcttttgttgctggaaagctgct
caaatcaaagaacatttactgaagtcaaagtggtgccgccctacatctctcaatgtggtt
cgaataattacatcagagctctatcgatcactgggagatgtcctccgtgatgttgatgcc
aaggctttggtgcgctctgactttcttctggtgtatggggatgtcatctcaaacatcaat
atcaccagagcccttgaggaacacaggttgagacggaagctagaaaaaaatgtttctgtg
atgacgatgatcttcaaggagtcatcccccagccacccaactcgttgccacgaagacaat
gtggtagtggctgtggatagtaccacaaacagggttctccattttcagaagacccagggt
ctccggcgttttgcatttcctctgagcctgtttcagggcagtagtgatggagtggaggtt
cgatatgatttactggattgtcatatcagcatctgttctcctcaggtggcacaactcttt
acagacaactttgactaccaaactcgagatgactttgtgcgaggtctcttagtgaatgag
gagatcctagggaaccagatccacatgcacgtaacagctaaggaatatggtgcccgtgtc
tccaacctacacatgtactcagctgtctgtgctgacgtcatccgccgatgggtctaccct
ctcaccccagaggcgaacttcactgacagcaccacccagagctgcactcattcccggcac
aacatctaccgagggcctgaggtcagcctgggccatggcagcatcctagaggaaaatgtg
ctcctgggctctggcactgtcattggcagcaattgctttatcaccaacagtgtcattggc
cccggctgccacattggtgataacgtggtgctggaccagacctacctgtggcagggtgtt
cgagtggcggctggagcacagatccatcagtctctgctttgtgacaatgctgaggtcaag
gaacgagtgacactgaaaccacgctctgtcctcacttcccaggtggtcgtgggcccaaat
atcacgctgcctgagggctcggtgatctctttgcaccctccagatgcagaggaagatgaa
gatgatggcgagttcagtgatgattctggggctgaccaagaaaaggacaaagtgaagatg
aaaggttacaatccagcagaagtaggagctgctggcaagggctacctctggaaagctgca
ggcatgaacatggaggaagaggaggaactgcagcagaatctgtggggactcaagatcaac
atggaagaagagagtgaaagtgaaagtgagcaaagtatggattctgaggagccggacagc
cggggaggctcccctcagatggatgacatcaaagtgttccagaatgaagttttaggaaca
ctacagcggggcaaagaggagaacatttcttgtgacaatctcgtcctggaaatcaactct
ctcaagtatgcctataacataagtctaaaggaggtgatgcaggtactgagccacgtggtc
ctggagttccccctgcaacagatggattccccgcttgactcaagccgctactgtgccctg
ctgcttcctctgctaaaggcctggagccctgtttttaggaactacataaagcgcgcagcc
gaccatttggaagcgttagcagccattgaggacttcttcctagagcatgaagctcttggt
atttccatggccaaggtactgatggctttctaccagctggagatcctggctgaggaaaca
attctgagctggttcagccaaagagatacaactgacaagggccagcagttgcgcaagaat
caacagctgcagaggttcatccagtggctaaaagaggcagaagaggagtcatctgaagat
gactga

DBGET integrated database retrieval system