KEGG   Homo sapiens (human): 197258Help
Entry
197258            CDS       T01001                                 

Gene name
FCSK, 1110046B12Rik, CDGF2, FUK
Definition
(RefSeq) fucose kinase
  KO
K05305  fucokinase [EC:2.7.1.52]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00051  Fructose and mannose metabolism
hsa00520  Amino sugar and nucleotide sugar metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    197258 (FCSK)
   00520 Amino sugar and nucleotide sugar metabolism
    197258 (FCSK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.52  fucokinase
     197258 (FCSK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fucokinase GHMP_kinases_C GHMP_kinases_N
Motif
Other DBs
NCBI-GeneID: 197258
NCBI-ProteinID: NP_659496
OMIM: 608675
HGNC: 29500
Ensembl: ENSG00000157353
Vega: OTTHUMG00000074085
Pharos: Q8N0W3(Tbio)
UniProt: Q8N0W3
LinkDB All DBs
Position
16q22.1
AA seq 1084 aa AA seqDB search
MEQPKGVDWTVIILTCQYKDSVQVFQRELEVRQKREQIPAGTLLLAVEDPEKRVGSGGAT
LNALLVAAEHLSARAGFTVVTSDVLHSAWILILHMGRDFPFDDCGRAFTCLPVENPEAPV
EALVCNLDCLLDIMTYRLGPGSPPGVWVCSTDMLLSVPANPGISWDSFRGARVIALPGSP
AYAQNHGVYLTDPQGLVLDIYYQGTEAEIQRCVRPDGRVPLVSGVVFFSVETAERLLATH
VSPPLDACTYLGLDSGARPVQLSLFFDILHCMAENVTREDFLVGRPPELGQGDADVAGYL
QSARAQLWRELRDQPLTMAYVSSGSYSYMTSSASEFLLSLTLPGAPGAQIVHSQVEEQQL
LAAGSSVVSCLLEGPVQLGPGSVLQHCHLQGPIHIGAGCLVTGLDTAHSKALHGRELRDL
VLQGHHTRLHGSPGHAFTLVGRLDSWERQGAGTYLNVPWSEFFKRTGVRAWDLWDPETLP
AEYCLPSARLFPVLHPSRELGPQDLLWMLDHQEDGGEALRAWRASWRLSWEQLQPCLDRA
ATLASRRDLFFRQALHKARHVLEARQDLSLRPLIWAAVREGCPGPLLATLDQVAAGAGDP
GVAARALACVADVLGCMAEGRGGLRSGPAANPEWMRPFSYLECGDLAAGVEALAQERDKW
LSRPALLVRAARHYEGAGQILIRQAVMSAQHFVSTEQVELPGPGQWVVAECPARVDFSGG
WSDTPPLAYELGGAVLGLAVRVDGRRPIGARARRIPEPELWLAVGPRQDEMTVKIVCRCL
ADLRDYCQPHAPGALLKAAFICAGIVHVHSELQLSEQLLRTFGGGFELHTWSELPHGSGL
GTSSILAGTALAALQRAAGRVVGTEALIHAVLHLEQVLTTGGGWQDQVGGLMPGIKVGRS
RAQLPLKVEVEEVTVPEGFVQKLNDHLLLVYTGKTRLARNLLQDVLRSWYARLPAVVQNA
HSLVRQTEECAEGFRQGSLPLLGQCLTSYWEQKKLMAPGCEPLTVRRMMDVLAPHVHGQS
LAGAGGGGFLYLLTKEPQQKEALEAVLAKTEGLGNYSIHLVEVDTQGLSLKLLGTEASTC
CPFP
NT seq 3255 nt NT seq  +upstreamnt  +downstreamnt
atggagcagccgaagggagttgattggacagtcatcatcctgacctgccagtacaaggac
agtgtccaggtctttcagagagaactggaagtgcggcagaagcgggagcagatccctgct
gggacgctgttactggccgtggaggacccagagaagcgtgtgggcagcggaggagccacc
ctcaacgccctgctggtggctgctgaacacctgagtgcccgggcaggcttcactgtggtc
acatccgatgtcctgcactcggcctggatcctcattctgcacatgggtcgagacttcccc
tttgatgactgtggcagggctttcacctgcctccccgtggagaaccccgaggcccccgtg
gaagccttggtctgcaacctggactgcctgctggacatcatgacctatcggctgggcccg
ggctccccgccaggcgtgtgggtctgcagcaccgacatgctgctgtctgttcctgcaaat
cctggtatcagctgggacagcttccggggagccagagtgatcgccctcccagggagcccg
gcctacgctcagaatcatggcgtctacctaactgacccccagggccttgttttggacatt
tactaccagggcactgaggcagagattcagcggtgtgtcaggcctgatgggcgggtgcca
ctggtctctggggttgtcttcttctctgtggagactgccgagcgcctcctagccacccac
gtgagcccgcccctggatgcctgcacctacctaggcttggactccggagcccggcctgtc
cagctgtctctgttttttgacattctccactgcatggctgagaacgtgaccagggaggac
ttcctggtggggaggcccccagagttggggcaaggcgatgcagatgtagcgggttatctg
cagagcgcccgggcccagctgtggagggagcttcgcgatcagccccttaccatggcctat
gtctccagcggcagctacagctacatgacctcctcagccagtgagttcctgctcagcctc
acactccccggggctcctggggcccagattgtgcactcccaggtggaggagcagcagctt
ctggcggccgggagctctgtggtcagctgcctgctggagggccctgtccagctgggtcct
gggagcgtcctgcagcactgccacctgcagggccccattcacataggcgctggctgcttg
gtgactggcctggatacagcccactccaaggccctgcatggccgggagctgcgtgacctt
gtcctgcagggacaccacacgcggctacacggctccccgggccacgccttcaccctcgtt
ggccgtctggacagctgggagagacagggggcaggcacatatctcaacgtgccctggagt
gaattcttcaagaggacaggtgttcgagcctgggacctgtgggaccctgagacgctgccc
gcagagtactgccttcccagcgcccgcctctttcctgtgctccacccctcgagggagctg
ggaccccaggacctgctgtggatgctggaccaccaggaggatgggggcgaggccctgcga
gcctggcgggcctcctggcgcctgtcctgggagcagctgcagccgtgcctggatcgggct
gccacgctggcctctcgccgggacctgttcttccgccaggccctgcataaggcgcggcac
gtgctggaggcccggcaggacctcagcctgcgcccgctgatctgggctgctgtccgcgag
ggctgccccgggcccctgctggccacgctggaccaggttgcagctggggcaggagaccct
ggtgtggcggcacgggcactggcctgtgtggcggacgtcctgggctgcatggcagagggc
cgtgggggcttgcggagcgggccagctgccaaccctgagtggatgcggcccttctcatac
ctggagtgtggagacctggcagcgggcgtggaggcgcttgcccaggagagggacaagtgg
ctaagcaggccagccttgctggtgcgagcggcccgccactatgagggggctggtcagatc
ctgatccgccaggctgtgatgtcagcccagcactttgtctccacagagcaggtggaactg
ccgggacctgggcagtgggtggtggctgagtgcccggcccgtgtggatttctctgggggc
tggagtgacacgccaccccttgcctatgagcttggcggggctgtgctgggcctggctgtg
cgagtggacggccgccggcccatcggagccagggcacgccgcatcccggagcctgagctg
tggctggcggtggggcctcggcaggatgagatgactgtgaagatagtgtgccggtgcctg
gctgacctgcgggactactgccagcctcatgccccaggggccctgctgaaggcggccttc
atctgtgcagggatcgtgcatgtccactcggaactccagctgagtgagcagctgctccgc
accttcgggggcggctttgagctgcacacctggtctgagctgccccacggctctggcctg
ggcaccagcagcatcctggcaggcactgccctggctgccttgcagcgagccgcaggccgg
gtggtgggcacggaagccctgatccacgcagtgctgcacctggagcaggtgctcaccact
ggaggtggctggcaggaccaagtaggtggcctaatgcctggcatcaaggtggggcgctcc
cgggctcagctgccactgaaggtggaggtagaagaggtcacggtgcctgagggctttgtc
cagaagctcaatgaccacctgctcttggtgtacactggcaagacccgcctggctcggaac
ctgctgcaggatgtgctgaggagctggtatgcccgacttcctgctgtggtgcagaatgcc
cacagcctggtacggcaaactgaggagtgtgctgaaggcttccgccaaggaagcctgcct
ctgctgggccagtgcctgacctcgtactgggagcagaagaagctcatggctccaggctgt
gagcccctgactgtgcggcgtatgatggatgtcctggccccccacgtgcatggccagagc
ctggctggggcaggcggtggaggctttctctatctgttgaccaaggagccacagcaaaag
gaggccttggaggcggtgctggccaagaccgagggccttgggaattacagcatccacctg
gttgaagtggacactcagggcctgagcctgaagctgctggggaccgaggcctcaacctgt
tgccctttcccatga

DBGET integrated database retrieval system