KEGG   Homo sapiens (human): 197259Help
Entry
197259            CDS       T01001                                 

Gene name
MLKL, hMLKL
Definition
(RefSeq) mixed lineage kinase domain like pseudokinase
  KO
K08849  mixed lineage kinase domain-like [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04668  TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    197259 (MLKL)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    197259 (MLKL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    197259 (MLKL)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     197259 (MLKL)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: TKL group
  Other
   197259 (MLKL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 197259
NCBI-ProteinID: NP_689862
OMIM: 615153
HGNC: 26617
Ensembl: ENSG00000168404
Vega: OTTHUMG00000177356
Pharos: Q8NB16(Tbio)
UniProt: Q8NB16
LinkDB All DBs
Structure
PDB: 

Position
16q23.1
AA seq 471 aa AA seqDB search
MENLKHIITLGQVIHKRCEEMKYCKKQCRRLGHRVLGLIKPLEMLQDQGKRSVPSEKLTT
AMNRFKAALEEANGEIEKFSNRSNICRFLTASQDKILFKDVNRKLSDVWKELSLLLQVEQ
RMPVSPISQGASWAQEDQQDADEDRRAFQMLRRDNEKIEASLRRLEINMKEIKETLRQYL
PPKCMQEIPQEQIKEIKKEQLSGSPWILLRENEVSTLYKGEYHRAPVAIKVFKKLQAGSI
AIVRQTFNKEIKTMKKFESPNILRIFGICIDETVTPPQFSIVMEYCELGTLRELLDREKD
LTLGKRMVLVLGAARGLYRLHHSEAPELHGKIRSSNFLVTQGYQVKLAGFELRKTQTSMS
LGTTREKTDRVKSTAYLSPQELEDVFYQYDVKSEIYSFGIVLWEIATGDIPFQGCNSEKI
RKLVAVKRQQEPLGEDCPSELREIIDECRAHDPSVRPSVDEILKKLSTFSK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatttgaagcatattatcacccttggccaggtcatccacaaacggtgtgaagag
atgaaatactgcaagaaacagtgccggcgcctgggccaccgcgtcctcggcctgatcaag
cctctggagatgctccaggaccaaggaaagaggagcgtgccctctgagaagttaaccaca
gccatgaaccgcttcaaggctgccctggaggaggctaatggggagatagaaaagttcagc
aatagatccaatatctgcaggtttctaacagcaagccaggacaaaatactcttcaaggac
gtgaacaggaagctgagtgatgtctggaaggagctctcgctgttacttcaggttgagcaa
cgcatgcctgtttcacccataagccaaggagcgtcctgggcacaggaagatcagcaggat
gcagacgaagacaggcgagctttccagatgctaagaagagataatgaaaaaatagaagct
tcactgagacgattagaaatcaacatgaaagaaatcaaggaaactttgaggcagtattta
ccaccaaaatgcatgcaggagatcccgcaagagcaaatcaaggagatcaagaaggagcag
ctttcaggatccccgtggattctgctaagggaaaatgaagtcagcacactttataaagga
gaataccacagagctccagtggccataaaagtattcaaaaaactccaggctggcagcatt
gcaatagtgaggcagactttcaataaggagatcaaaaccatgaagaaattcgaatctccc
aacatcctgcgtatatttgggatttgcattgatgaaacagtgactccgcctcaattctcc
attgtcatggagtactgtgaactcgggaccctgagggagctgttggatagggaaaaagac
ctcacacttggcaagcgcatggtcctagtcctgggggcagcccgaggcctataccggcta
caccattcagaagcacctgaactccacggaaaaatcagaagctcaaacttcctggtaact
caaggctaccaagtgaagcttgcaggatttgagttgaggaaaacacagacttccatgagt
ttgggaactacgagagaaaagacagacagagtcaaatctacagcatatctctcacctcag
gaactggaagatgtattttatcaatatgatgtaaagtctgaaatatacagctttggaatc
gtcctctgggaaatcgccactggagatatcccgtttcaaggctgtaattctgagaagatc
cgcaagctggtggctgtgaagcggcagcaggagccactgggtgaagactgcccttcagag
ctgcgggagatcattgatgagtgccgggcccatgatccctctgtgcggccctctgtggat
gaaatcttaaagaaactctccaccttttctaagtag

DBGET integrated database retrieval system