KEGG   Homo sapiens (human): 1975Help
Entry
1975              CDS       T01001                                 

Gene name
EIF4B, EIF-4B, PRO1843
Definition
(RefSeq) eukaryotic translation initiation factor 4B
  KO
K03258  translation initiation factor 4B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04150  mTOR signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    1975 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    1975 (EIF4B)
   04150 mTOR signaling pathway
    1975 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    1975 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    1975 (EIF4B)
   03012 Translation factors [BR:hsa03012]
    1975 (EIF4B)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     1975 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     1975 (EIF4B)
Translation factors [BR:hsa03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    1975 (EIF4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 RRM_7
Motif
Other DBs
NCBI-GeneID: 1975
NCBI-ProteinID: NP_001408
OMIM: 603928
HGNC: 3285
Ensembl: ENSG00000063046
Vega: OTTHUMG00000169570
Pharos: P23588(Tbio)
UniProt: P23588
LinkDB All DBs
Structure
PDB: 

Position
12q13.13
AA seq 611 aa AA seqDB search
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVSKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEESIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSTRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSTTSSRNARRRESEKSLENETLNKEEDCHSPTSKPPKPDQPLKVMPAPPPK
ENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQT
GNSSRGPGDGGNRDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
EDENEGEDYAE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaagactatctccctaacagacttt
ctggctgaggatgggggtactggtggaggaagcacctatgtttccaaaccagtcagctgg
gctgatgaaacggatgacctggaaggagatgtttcgaccacttggcacagtaacgatgac
gatgtgtatagggcgcctccaattgaccgttccatccttcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttcccaaatcgccaccctacactgcttttcta
ggaaacctaccctatgatgttacagaagagtcaattaaggaattctttcgaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatccagagaggttgaaaggttttggt
tatgctgaatttgaggacctggattccctgctcagtgccctgagtctcaatgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaggataaagacagggat
gatcgttcttttggccgtgatagaaatcgggattctgacaaaacagatacagactggagg
gctcgtcctgctacagacagctttgatgactacccacctagaagaggtgatgatagcttt
ggagacaagtatcgagatcgttatgattcagaccggtatcgggatgggtatcgggatggg
tatcgggatggcccacgccgggatatggatcgatatggtggccgggatcgctatgatgac
cgaggcagcagagactatgatagaggctatgattcccggataggcagtggcagaagagca
tttggcagtgggtatcgcagggatgatgactacagaggaggcggggaccgctatgaagac
cgatatgacagacgggatgatcggtcgtggagctccagagatgattactctcgggatgat
tataggcgtgatgatagaggtcccccccaaagacccaaactgaatctaaagcctcggagt
actcctaaggaagatgattcctctgctagtacctcccagtccactcgagctgcttctatc
tttggaggggcaaagcctgttgacacagctgctagagaaagagaagtagaagaacggcta
cagaaggaacaagagaagttgcagcgtcagctggatgagccaaaactagaacgacggcct
cgggagagacacccaagctggcgaagtgaagaaactcaggaacgggaacggtcgaggaca
ggaagtgagtcatcacaaactgggacctccaccacatctagcagaaatgcacgaaggaga
gagagtgagaagtctctagaaaatgaaacactcaataaggaggaagattgccactctcca
acttctaaacctcccaaacctgatcagcccctaaaggtaatgccagcccctccaccaaag
gagaatgcttgggtgaagcgaagttctaaccctcctgctcgatctcagagctcagacaca
gagcagcagtcccctacaagtggtgggggaaaagtagctccagctcaaccatctgaggaa
ggaccaggaaggaaagatgaaaataaagtagatgggatgaatgccccaaaaggccaaact
gggaactctagccgtggtccaggagacggagggaacagagaccactggaaggagtcagat
aggaaagatggcaaaaaggatcaagactccagatctgcacctgagccaaagaaacctgag
gaaaatccagcttccaagttcagttctgcaagcaagtatgctgctctctctgttgatggt
gaagatgaaaatgagggagaagattatgccgaatag

DBGET integrated database retrieval system