KEGG   Homo sapiens (human): 200186
Entry
200186            CDS       T01001                                 

Gene name
CRTC2, TORC-2, TORC2
Definition
(RefSeq) CREB regulated transcription coactivator 2
  KO
K16333  CREB-regulated transcription coactivator 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    200186 (CRTC2)
   04152 AMPK signaling pathway
    200186 (CRTC2)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    200186 (CRTC2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    200186 (CRTC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    200186 (CRTC2)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 200186
NCBI-ProteinID: NP_859066
OMIM: 608972
HGNC: 27301
Ensembl: ENSG00000160741
Vega: OTTHUMG00000037156
Pharos: Q53ET0(Tbio)
UniProt: Q53ET0
LinkDB
Structure
PDB: 
4HTM

Position
1q21.3
AA seq 693 aa
MATSGANGPGSATASASNPRKFSEKIALQKQRQAEETAAFEEVMMDIGSTRLQAQKLRLA
YTRSSHYGGSLPNVNQIGSGLAEFQSPLHSPLDSSRSTRHHGLVERVQRDPRRMVSPLRR
YTRHIDSSPYSPAYLSPPPESSWRRTMAWGNFPAEKGQLFRLPSALNRTSSDSALHTSVM
NPSPQDTYPGPTPPSILPSRRGGILDGEMDPKVPAIEENLLDDKHLLKPWDAKKLSSSSS
RPRSCEVPGINIFPSPDQPANVPVLPPAMNTGGSLPDLTNLHFPPPLPTPLDPEETAYPS
LSGGNSTSNLTHTMTHLGISRGMGLGPGYDAPGLHSPLSHPSLQSSLSNPNLQASLSSPQ
PQLQGSHSHPSLPASSLARHVLPTTSLGHPSLSAPALSSSSSSSSTSSPVLGAPSYPAST
PGASPHHRRVPLSPLSLLAGPADARRSQQQLPKQFSPTMSPTLSSITQGVPLDTSKLSTD
QRLPPYPYSSPSLVLPTQPHTPKSLQQPGLPSQSCSVQSSGGQPPGRQSHYGTPYPPGPS
GHGQQSYHRPMSDFNLGNLEQFSMESPSASLVLDPPGFSEGPGFLGGEGPMGGPQDPHTF
NHQNLTHCSRHGSGPNIILTGDSSPGFSKEIAAALAGVPGFEVSAAGLELGLGLEDELRM
EPLGLEGLNMLSDPCALLPDPAVEESFRSDRLQ
NT seq 2082 nt   +upstreamnt  +downstreamnt
atggcgacgtcgggggcgaacgggcctggttcggccacggcctcggcttccaatccgcgc
aaatttagtgagaagattgcgctgcagaagcagcgtcaggccgaggagacggcggccttc
gaggaggtgatgatggacatcggctccacccggttacaggcccaaaaactgcgactggca
tacacaaggagctctcattatggtgggtctctgcccaatgttaaccagattggctctggc
ctggccgagttccagagccccctccactcacctttggattcatctcggagcactcggcac
catgggctggtggaacgggtgcagcgagatcctcgaagaatggtgtccccacttcgccga
tacacccgccacattgacagctctccctatagtcctgcctacttatctcctcccccagag
tctagctggcgaaggacgatggcctggggcaatttccctgcagagaaggggcagttgttt
cgactaccatctgcacttaacaggacaagctctgactctgcccttcatacaagtgtgatg
aaccccagtccccaggatacctacccaggccccacacctcccagcatcctgcccagccga
cgtgggggtattctggatggtgaaatggaccccaaagtacctgctattgaggagaacttg
ctagatgacaagcatttgctgaagccatgggatgctaagaagctatcctcatcctcttcc
cgacctcggtcctgtgaagtccctggaattaacatctttccatctcctgaccagcctgcc
aatgtgcctgtcctcccacctgccatgaacacggggggctccctacctgacctcaccaac
ctgcactttcccccaccactgcccacccccctggaccctgaagagacagcctaccctagc
ctgagtgggggcaacagtacctccaatttgacccacaccatgactcacctgggcatcagc
aggggcatgggcctgggcccaggctatgatgcaccaggacttcattcacctctcagccac
ccatccctgcagtcctccctaagcaatcccaacctccaggcttccctgagcagtcctcag
ccccagcttcagggctcccacagccacccctctctgcctgcctcctccttggcccgccat
gtactgcccaccacctccctgggccacccctcactcagtgctccggctctctcctcctcc
tcttcctcctcctccacttcatctcctgttttgggcgccccctcttaccctgcttctacc
cctggggcctccccccaccaccgccgtgtgcccctcagccccctgagtttgctcgcgggc
ccagccgacgccagaaggtcccaacagcagctgcccaaacagttttcgccaacaatgtca
cccaccttgtcttccatcactcagggcgtccccctggataccagtaaactgtccactgac
cagcggttacccccatacccatacagctccccaagtctggttctgcctacccagccccac
accccaaagtctctacagcagccagggctgccctctcagtcttgttcagtgcagtcctca
ggtgggcagcccccaggcaggcagtctcattatgggacaccgtacccacctgggcccagt
gggcatgggcaacagtcttaccaccggccaatgagtgacttcaacctggggaatctggag
cagttcagcatggagagcccatcagccagcctggtgctggatccccctggcttttctgaa
gggcctggatttttagggggtgaggggccaatgggtggcccccaggatccccacaccttc
aaccaccagaacttgacccactgttcccgccatggctcagggcctaacatcatcctcaca
ggggactcctctccaggtttctctaaggagattgcagcagccctggccggagtgcctggc
tttgaggtgtcagcagctggattggagctagggcttgggctagaagatgagctgcgcatg
gagccactgggcctggaagggctaaacatgctgagtgacccctgtgccctgctgcctgat
cctgctgtggaggagtcattccgcagtgaccggctccaatga

DBGET integrated database retrieval system