KEGG   Homo sapiens (human): 2005
Entry
2005              CDS       T01001                                 

Gene name
ELK4, SAP1
Definition
(RefSeq) ETS transcription factor ELK4
  KO
K04376  ETS domain-containing protein Elk-4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
hsa05202  Transcriptional misregulation in cancer
Disease
H00024  Prostate cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    2005 (ELK4)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2005 (ELK4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2005 (ELK4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2005 (ELK4)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2005 (ELK4)
SSDB
Motif
Pfam: Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 2005
NCBI-ProteinID: NP_001964
OMIM: 600246
HGNC: 3326
Ensembl: ENSG00000158711
Vega: OTTHUMG00000037221
Pharos: P28324(Tbio)
UniProt: P28324 A0A024R985 Q8IXL1
LinkDB
Structure
PDB: 
1BC8 1BC7 1HBX 1K6O

Position
1q32.1
AA seq 431 aa
MDSAITLWQFLLQLLQKPQNKHMICWTSNDGQFKLLQAEEVARLWGIRKNKPNMNYDKLS
RALRYYYVKNIIKKVNGQKFVYKFVSYPEILNMDPMTVGRIEGDCESLNFSEVSSSSKDV
ENGGKDKPPQPGAKTSSRNDYIHSGLYSSFTLNSLNSSNVKLFKLIKTENPAEKLAEKKS
PQEPTPSVIKFVTTPSKKPPVEPVAATISIGPSISPSSEETIQALETLVSPKLPSLEAPT
SASNVMTAFATTPPISSIPPLQEPPRTPSPPLSSHPDIDTDIDSVASQPMELPENLSLEP
KDQDSVLLEKDKVNNSSRSKKPKGLELAPTLVITSSDPSPLGILSPSLPTASLTPAFFSQ
TPIILTPSPLLSSIHFWSTLSPVAPLSPARLQGANTLFQFPSVLNSHGPFTLSGLDGPST
PGPFSPDLQKT
NT seq 1296 nt   +upstreamnt  +downstreamnt
atggacagtgctatcaccctgtggcagttccttcttcagctcctgcagaagcctcagaac
aagcacatgatctgttggacctctaatgatgggcagtttaagcttttgcaggcagaagag
gtggctcgtctctgggggattcgcaagaacaagcctaacatgaattatgacaaactcagc
cgagccctcagatactattatgtaaagaatatcatcaaaaaagtgaatggtcagaagttt
gtgtacaagtttgtctcttatccagagattttgaacatggatccaatgacagtgggcagg
attgagggtgactgtgaaagtttaaacttcagtgaagtcagcagcagttccaaagatgtg
gagaatggagggaaagataaaccacctcagcctggtgccaagacctctagccgcaatgac
tacatacactctggcttatattcttcatttactctcaactctttgaactcctccaatgta
aagcttttcaaattgataaagactgagaatccagccgagaaactggcagagaaaaaatct
cctcaggagcccacaccatctgtcatcaaatttgtcacgacaccttccaaaaagccaccg
gttgaacctgttgctgccaccatttcaattggcccaagtatttctccatcttcagaagaa
actatccaagctttggagacattggtttccccaaaactgccttccctggaagccccaacc
tctgcctctaacgtaatgactgcttttgccaccacaccacccatttcgtccataccccct
ttgcaggaacctcccagaacaccttcaccaccactgagttctcacccagacatcgacaca
gacattgattcagtggcttctcagccaatggaacttccagagaatttgtcactggagcct
aaagaccaggattcagtcttgctagaaaaggacaaagtaaataattcatcaagatccaag
aaacccaaagggttagaactggcacccacccttgtgatcacgagcagtgatccaagccca
ctgggaatactgagcccatctctccctacagcttctcttacaccagcatttttttcacag
acacccatcatactgactccaagccccttgctctccagtatccacttctggagtactctc
agtcctgttgctcccctaagtccagccagactgcaaggtgctaacacacttttccagttt
ccttctgtactgaacagtcatgggccattcactctgtctgggctggatggaccttccacc
cctggcccattttccccagacctacagaagacataa

DBGET integrated database retrieval system