KEGG   Homo sapiens (human): 200576Help
Entry
200576            CDS       T01001                                 

Gene name
PIKFYVE, CFD, FAB1, HEL37, PIP5K, PIP5K3, ZFYVE29
Definition
(RefSeq) phosphoinositide kinase, FYVE-type zinc finger containing
  KO
K00921  1-phosphatidylinositol-3-phosphate 5-kinase [EC:2.7.1.150]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00562  Inositol phosphate metabolism
hsa01100  Metabolic pathways
hsa04070  Phosphatidylinositol signaling system
hsa04145  Phagosome
hsa04810  Regulation of actin cytoskeleton
Disease
H00957  Fleck corneal dystrophy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    200576 (PIKFYVE)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    200576 (PIKFYVE)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    200576 (PIKFYVE)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    200576 (PIKFYVE)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    200576 (PIKFYVE)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.150  1-phosphatidylinositol-3-phosphate 5-kinase
     200576 (PIKFYVE)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Macropinocytosis
   Kinases
    200576 (PIKFYVE)
 Endosome - Golgi transport
  Others
   Others
    200576 (PIKFYVE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PIP5K Cpn60_TCP1 DEP FYVE
Motif
Other DBs
NCBI-GeneID: 200576
NCBI-ProteinID: NP_055855
OMIM: 609414
HGNC: 23785
Ensembl: ENSG00000115020
Vega: OTTHUMG00000132945
Pharos: Q9Y2I7(Tbio)
UniProt: Q9Y2I7
LinkDB All DBs
Position
2q34
AA seq 2098 aa AA seqDB search
MATDDKTSPTLDSANDLPRSPTSPSHLTHFKPLTPDQDEPPFKSAYSSFVNLFRFNKERA
EGGQGEQQPLSGSWTSPQLPSRTQSVRSPTPYKKQLNEELQRRSSALDTRRKAEPTFGGH
DPRTAVQLRSLSTVLKRLKEIMEGKSQDSDLKQYWMPDSQCKECYDCSEKFTTFRRRHHC
RLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSNSIGEDLNALSDSA
CSVSVLDPSEPRTPVGSRKASRNIFLEDDLAWQSLIHPDSSNTPLSTRLVSVQEDAGKSP
ARNRSASITNLSLDRSGSPMVPSYETSVSPQANRTYVRTETTEDERKILLDSVQLKDLWK
KICHHSSGMEFQDHRYWLRTHPNCIVGKELVNWLIRNGHIATRAQAIAIGQAMVDGRWLD
CVSHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQI
AEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPH
PADQKEYLISDTGGQQLSISDAFIKESLFNRRVEEKSKELPFTPLGWHHNNLELLREENG
EKQAMERLLSANHNHMMALLQQLLHSDSLSSSWRDIIVSLVCQVVQTVRPDVKNQDDDMD
IRQFVHIKKIPGGKKFDSVVVNGFVCTKNIAHKKMSSCIKNPKILLLKCSIEYLYREETK
FTCIDPIVLQEREFLKNYVQRIVDVRPTLVLVEKTVSRIAQDMLLEHGITLVINVKSQVL
ERISRMTQGDLVMSMDQLLTKPHLGTCHKFYMQIFQLPNEQTKTLMFFEGCPQHLGCTIK
LRGGSDYELARVKEILIFMICVAYHSQLEISFLMDEFAMPPTLMQNPSFHSLIEGRGHEG
AVQEQYGGGSIPWDPDIPPESLPCDDSSLLELRIVFEKGEQENKNLPQAVASVKHQEHST
TACPAGLPCAFFAPVPESLLPLPVDDQQDALGSEQPETLQQTVVLQDPKSQIRAFRDPLQ
DDTGLYVTEEVTSSEDKRKTYSLAFKQELKDVILCISPVITFREPFLLTEKGMRCSTRDY
FAEQVYWSPLLNKEFKEMENRRKKQLLRDLSGLQGMNGSIQAKSIQVLPSHELVSTRIAE
HLGDSQSLGRMLADYRARGGRIQPKNSDPFAHSKDASSTSSGQSGSKNEGDEERGLILSD
AVWSTKVDCLNPINHQRLCVLFSSSSAQSSNAPSACVSPWIVTMEFYGKNDLTLGIFLER
YCFRPSYQCPSMFCDTPMVHHIRRFVHGQGCVQIILKELDSPVPGYQHTILTYSWCRICK
QVTPVVALSNESWSMSFAKYLELRFYGHQYTRRANAEPCGHSIHHDYHQYFSYNQMVASF
SYSPIRLLEVCVPLPKIFIKRQAPLKVSLLQDLKDFFQKVSQVYVAIDERLASLKTDTFS
KTREEKMEDIFAQKEMEEGEFKNWIEKMQARLMSSSVDTPQQLQSVFESLIAKKQSLCEV
LQAWNNRLQDLFQQEKGRKRPSVPPSPGRLRQGEESKISAMDASPRNISPGLQNGEKEDR
FLTTLSSQSSTSSTHLQLPTPPEVMSEQSVGGPPELDTASSSEDVFDGHLLGSTDSQVKE
KSTMKAIFANLLPGNSYNPIPFPFDPDKHYLMYEHERVPIAVCEKEPSSIIAFALSCKEY
RNALEELSKATQWNSAEEGLPTNSTSDSRPKSSSPIRLPEMSGGQTNRTTETEPQPTKKA
SGMLSFFRGTAGKSPDLSSQKRETLRGADSAYYQVGQTGKEGTENQGVEPQDEVDGGDTQ
KKQLINPHVELQFSDANAKFYCRLYYAGEFHKMREVILDSSEEDFIRSLSHSSPWQARGG
KSGAAFYATEDDRFILKQMPRLEVQSFLDFAPHYFNYITNAVQQKRPTALAKILGVYRIG
YKNSQNNTEKKLDLLVMENLFYGRKMAQVFDLKGSLRNRNVKTDTGKESCDVVLLDENLL
KMVRDNPLYIRSHSKAVLRTSIHSDSHFLSSHLIIDYSLLVGRDDTSNELVVGIIDYIRT
FTWDKKLEMVVKSTGILGGQGKMPTVVSPELYRTRFCEAMDKYFLMVPDHWTGLGLNC
NT seq 6297 nt NT seq  +upstreamnt  +downstreamnt
atggccacagatgataagacgtccccaacactggactctgctaatgatttgcctcgatct
cctactagtccttctcatctcacacactttaaacctttgactcctgatcaagatgagccc
ccttttaaatcagcttatagttcttttgtaaatctctttcgttttaacaaagagagagca
gaaggaggccagggagaacagcagcctttgagtggaagttggaccagccctcagctccct
tcgaggacacagtctgttaggtcacccacaccttataaaaagcagcttaatgaggaactc
cagcggcgctcttcagcattagacacaagaaggaaagcagaacctacctttggaggtcat
gaccctcgtacagctgttcagcttcgaagcctcagcacagtattaaaacgcctcaaggaa
atcatggaggggaaaagccaggatagtgacctgaaacaatactggatgccagatagccaa
tgtaaagagtgctatgactgtagtgagaaatttacaacctttaggcgcagacaccattgc
cgactatgtgggcagattttctgcagtcgttgctgtaatcaagaaatccctggaaaattt
atgggctatacaggagacctccgagcttgcacatattgtagaaaaatagccttaagttat
gctcattccacagacagtaattctattggggaagacttgaatgctctttcagattctgct
tgctctgtgtctgtgcttgatccaagtgaaccccgaacacctgttgggagtaggaaagcc
agccgtaacatatttttagaggatgatttggcctggcaaagtttgattcatccagattcc
tcaaatactcctctttcaacaagacttgtatctgtgcaagaggatgctgggaaatctcct
gctcgaaatagatcagccagcattactaacctgtcactggatagatctggttctcctatg
gtaccttcatatgagacatctgtcagtccccaggctaaccgaacatatgttaggacagag
accactgaggatgaacgcaaaattcttctggacagtgtgcagttaaaagacctgtggaaa
aaaatctgccatcacagcagtggaatggagtttcaggatcaccgctactggttgagaacg
catcccaactgcattgtaggaaaggaattagtcaactggctaatccgaaatgggcatatt
gccacaagggcacaagctatagcaattggacaagcaatggttgatggacgttggctggat
tgtgttagtcatcacgaccagcttttcagagatgagtatgcgctgtatagaccactgcag
agtacagaattttctgagacgccttctcccgacagtgactcagtgaactccgtggaagga
cactctgagccatcctggtttaaagacataaagtttgatgacagtgacacagaacagata
gctgaagaaggtgacgataatttggctaattctgccagtcctagcaagcgcacatcagtc
agcagtttccagtccacagtggacagtgactcagccgcttctatcagcctgaacgtggag
ctggacaacgtgaacttccatatcaagaagccctccaagtacccacatgtgccccctcac
cctgctgaccaaaaagagtatttgatttctgacactggaggacaacagctctcaataagt
gacgctttcatcaaagaatccttatttaatcgccgagtagaggaaaaatccaaagagctg
cctttcacacctttgggctggcatcataacaacctggagctcctgagggaggagaatggg
gagaaacaagccatggagaggttgctttcagctaatcataaccacatgatggcactactc
cagcagttgctccatagtgactcactgtcatcatcttggagggacatcatcgtgtcattg
gtctgccaggttgttcagacagtccgacctgatgtcaagaaccaggatgatgacatggat
atccgtcagtttgtccacatcaaaaaaatcccaggtggaaagaagtttgattctgtggtt
gtcaatggctttgtttgtaccaagaacattgcacataaaaagatgagttcttgtattaaa
aaccccaaaattcttctgttgaagtgttccattgagtatctctacagagaagaaactaag
tttacttgcattgatcctattgtgcttcaggaaagggaattcttgaagaattatgtccag
cgaatagttgatgttcgacccaccttggttcttgttgagaaaacagtgtctcggattgcc
caggacatgttattggaacatggcattactttggtcattaatgtaaagtcacaagttttg
gaacgaatcagtcgaatgacccaaggtgatttagtgatgtcaatggaccagctgcttacg
aaaccacacctgggcacttgtcacaaattttatatgcagatatttcagttgcctaatgaa
caaaccaagacactgatgttttttgaaggttgtccacagcacctaggctgtacaatcaag
ctaagaggaggctctgattatgagctggctcgagttaaggagatcctaatatttatgatc
tgtgttgcttatcattctcaactagaaatatcctttctcatggatgaatttgctatgcct
cccacattaatgcaaaacccttcattccattccctgattgagggacgagggcatgagggg
gctgtccaagagcagtacggtggaggttccatcccctgggatcctgacatccctcctgag
tctctgccctgtgatgatagcagtttgctggaattgaggattgtgtttgagaagggtgag
caggaaaataaaaatcttccgcaggctgttgcctctgtgaagcatcaagaacatagcaca
acagcttgcccggcgggtctcccttgtgctttctttgcacctgtaccggaatcattgttg
ccactccctgtggatgaccaacaagatgctttaggcagcgagcagccagagactttgcag
caaacagttgtgctgcaggatcccaaaagccagataagagcctttagagaccctctacag
gatgacactggattatatgttactgaggaagtcacctcctctgaagataaacgaaagact
tattctttggcctttaagcaggaattaaaagatgtgatcctctgtatctccccagtaatc
acattccgagaaccctttcttttaactgaaaaggggatgagatgctctacccgagattat
tttgcagagcaggtttactggtctcctctcctcaataaagaattcaaagaaatggagaac
aggaggaagaaacagctgctcagggatctctctggacttcagggcatgaatggaagtatt
caggccaagtctattcaagtcttaccctcacatgagctagtgagcactagaattgctgag
catctgggcgatagccagagcttgggtagaatgctggccgattatcgagccagaggagga
agaattcagcccaaaaattcagacccttttgctcattcaaaggatgcatcaagtacttca
agtggccaatcaggaagcaaaaatgagggtgatgaagagagagggcttattctgagtgat
gctgtgtggtcaacaaaggtggactgtctgaatcccattaatcaccagagactttgtgtg
ctcttcagcagctcttctgcccagtccagcaatgctcctagtgcctgtgtcagtccttgg
attgtaacaatggaattttatggaaagaatgatcttacattaggaatatttttagagaga
tactgtttcaggccttcttatcagtgtccaagcatgttctgtgatacccccatggtacat
catattcggcgctttgttcatggccaaggctgtgtgcagataatcctgaaggagttggat
tctccagtacctggatatcagcatacaattcttacatattcctggtgtagaatctgcaaa
caggtaacaccagttgttgctctttccaatgagtcctggtctatgtcatttgcaaaatac
cttgaacttaggttttatgggcaccagtatactcgcagagccaacgctgagccctgtggt
cactccatccatcatgattatcaccagtatttctcctataaccagatggtggcgtctttc
agttattctcccattcggcttcttgaagtatgtgttccactccccaaaatattcattaag
cgtcaggccccattaaaagtgtcccttcttcaggatctgaaggacttctttcaaaaagtt
tcacaggtatatgttgccattgatgaaagacttgcatctttgaaaactgatacatttagt
aaaacaagagaggaaaaaatggaagatatttttgcacagaaagagatggaagaaggtgag
ttcaagaactggattgagaagatgcaagcaaggctcatgtcttcctctgtagatacccct
cagcaactgcagtcggtctttgagtcactcattgccaagaaacaaagtctctgtgaagtg
ctgcaagcttggaataacaggttgcaggaccttttccaacaggaaaagggtagaaagaga
ccttcagttcctccaagtcctggaagactgagacaaggggaagaaagcaagataagtgcg
atggatgcatctccacggaatatttctccaggacttcagaatggagaaaaagaggatcgc
ttcttaacaactttgtccagccagagctccaccagttctactcatctccaattgcctacg
ccacctgaagtcatgtctgaacagtcagtgggagggccccctgagctagatacagccagc
agttccgaagatgtgtttgatgggcatttgctgggatccacagacagccaagtgaaggaa
aagtcaaccatgaaagccatctttgcaaatttgcttccaggaaatagctataatcctatt
ccatttccttttgatccagataaacactacttaatgtatgaacatgaacgagtgcccatt
gcagtctgcgagaaggaacccagctccatcattgcttttgctctcagttgtaaagaatac
cgaaatgccttagaggaattgtctaaagcgactcagtggaacagtgccgaagaagggctt
ccaacaaatagtacttcagatagcagaccaaagagtagcagccctatcagattacctgaa
atgagtggaggacagacaaatcgtacaacagaaacagaaccacaaccaaccaaaaaggct
tctggaatgttgtccttcttcagagggacagcagggaaaagccccgatctctcttcccag
aagagagagaccttacgtggagcagatagtgcttactaccaggttgggcagacgggcaag
gaggggaccgagaatcaaggcgttgagcctcaagatgaagtagatggaggagatacacaa
aagaagcaactcataaatcctcatgtggaacttcaattttcagatgctaatgccaagttt
tactgtcggctctactatgcgggagagtttcataagatgcgtgaagtgattctggacagc
agtgaagaagatttcattcgttccctctcccactcatcaccctggcaggcccggggaggc
aaatcaggagctgccttctatgcaactgaggatgatagatttattttgaagcaaatgcct
cgtctggaagtccagtccttcctcgactttgcaccacattacttcaattatattacaaat
gctgttcaacaaaagaggcccacggcgttggccaaaattcttggagtttacagaattggt
tataagaactctcagaacaacactgagaagaagttagatctccttgtcatggaaaatctt
ttctacgggagaaagatggcacaggtttttgatttgaagggctctcttaggaatcggaat
gtaaaaactgacactggaaaagagagttgtgatgtggtcctgctagatgaaaatctccta
aagatggttcgagacaaccctctatatattcgttctcattccaaagctgtgctgagaacc
tcgatccatagtgactcccatttcctttctagccacctcattatagattattctttgctg
gttgggcgagatgatactagcaatgagctagtagttggaattatagattatattcgaaca
tttacatgggacaaaaagcttgagatggttgtgaaatcaacaggaattttaggtggacaa
ggtaaaatgccaacagtggtgtctccggagttgtacaggactaggttttgtgaggcaatg
gacaagtatttcctaatggtaccagaccactggacaggcttgggtctgaattgctga

DBGET integrated database retrieval system