KEGG   Homo sapiens (human): 200959
Entry
200959            CDS       T01001                                 

Gene name
GABRR3
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit rho3
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    200959 (GABRR3)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    200959 (GABRR3)
   04723 Retrograde endocannabinoid signaling
    200959 (GABRR3)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    200959 (GABRR3)
   05033 Nicotine addiction
    200959 (GABRR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    200959 (GABRR3)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   200959 (GABRR3)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 200959
NCBI-ProteinID: NP_001099050
OMIM: 618668
HGNC: 17969
Ensembl: ENSG00000183185
Vega: OTTHUMG00000159135
Pharos: A8MPY1(Tdark)
UniProt: A8MPY1
LinkDB
Position
3q11.2
AA seq 467 aa
MVLAFQLVSFTYIWIILKPNVCAASNIKMTHQRCSSSMKQTCKQETRMKKDDSTKARPQK
YEQLLHIEDNDFAMRPGFGGSPVPVGIDVHVESIDSISETNMDFTMTFYLRHYWKDERLS
FPSTANKSMTFDHRLTRKIWVPDIFFVHSKRSFIHDTTMENIMLRVHPDGNVLLSLRITV
SAMCFMDFSRFPLDTQNCSLELESYAYNEDDLMLYWKHGNKSLNTEEHMSLSQFFIEDFS
ASSGLAFYSSTGWYNRLFINFVLRRHVFFFVLQTYFPAILMVMLSWVSFWIDRRAVPARV
SLGITTVLTMSTIITAVSASMPQVSYLKAVDVYLWVSSLFVFLSVIEYAAVNYLTTVEER
KQFKKTGKISRMYNIDAVQAMAFDGCYHDSEIDMDQTSLSLNSEDFMRRKSICSPSTDSS
RIKRRKSLGGHVGRIILENNHVIDTYSRILFPIVYILFNLFYWGVYV
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtcctggctttccagttagtctccttcacctacatctggatcatattgaaaccaaat
gtttgtgctgcttctaacatcaagatgacacaccagcggtgctcctcttcaatgaaacaa
acctgcaaacaagaaactagaatgaagaaagatgacagtaccaaagcgcggcctcagaaa
tatgagcaacttctccatatagaggacaacgatttcgcaatgagacctggatttggaggg
tctccagtgccagtaggtatagatgtccatgttgaaagcattgacagcatttcagagact
aacatggactttacaatgactttttatctcaggcattactggaaagacgagaggctctcc
tttcctagcacagcaaacaaaagcatgacatttgatcatagattgaccagaaagatctgg
gtgcctgatatcttttttgtccactctaaaagatccttcatccatgatacaactatggag
aatatcatgctgcgcgtacaccctgatggaaacgtcctcctaagtctcaggataacggtt
tcggccatgtgctttatggatttcagcaggtttcctcttgacactcaaaattgttctctt
gaactggaaagctatgcctacaatgaggatgacctaatgctatactggaaacacggaaac
aagtccttaaatactgaagaacatatgtccctttctcagttcttcattgaagacttcagt
gcatctagtggattagctttctatagcagcacaggttggtacaataggcttttcatcaac
tttgtgctaaggaggcatgttttcttctttgtgctgcaaacctatttcccagccatattg
atggtgatgctttcatgggtttcattttggattgaccgaagagctgttcctgcaagagtt
tccctgggaatcaccacagtgctgaccatgtccacaatcatcactgctgtgagcgcctcc
atgccccaggtgtcctacctcaaggctgtggatgtgtacctgtgggtcagctccctcttt
gtgttcctgtcagtcattgagtatgcagctgtgaactacctcaccacagtggaagagcgg
aaacaattcaagaagacaggaaagatttctaggatgtacaatattgatgcagttcaagct
atggcctttgatggttgttaccatgacagcgagattgacatggaccagacttccctctct
ctaaactcagaagacttcatgagaagaaaatcgatatgcagccccagcaccgattcatct
cggataaagagaagaaaatccctaggaggacatgttggtagaatcattctggaaaacaac
catgtcattgacacctattctaggattttattccccattgtgtatattttatttaatttg
ttttactggggtgtatatgtatga

KEGG   Homo sapiens (human): 2569
Entry
2569              CDS       T01001                                 

Gene name
GABRR1
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit rho1
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2569 (GABRR1)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2569 (GABRR1)
   04723 Retrograde endocannabinoid signaling
    2569 (GABRR1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2569 (GABRR1)
   05033 Nicotine addiction
    2569 (GABRR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2569 (GABRR1)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2569 (GABRR1)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2569
NCBI-ProteinID: NP_002033
OMIM: 137161
HGNC: 4090
Ensembl: ENSG00000146276
Vega: OTTHUMG00000015195
Pharos: P24046(Tchem)
UniProt: P24046
LinkDB
Position
6q15
AA seq 479 aa
MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHEDAHKQVSPI
LRRSPDITKSPLTKSEQLLRIDDHDFSMRPGFGGPAIPVGVDVQVESLDSISEVDMDFTM
TLYLRHYWKDERLSFPSTNNLSMTFDGRLVKKIWVPDMFFVHSKRSFIHDTTTDNVMLRV
QPDGKVLYSLRVTVTAMCNMDFSRFPLDTQTCSLEIESYAYTEDDLMLYWKKGNDSLKTD
ERISLSQFLIQEFHTTTKLAFYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSW
VSFWIDRRAVPARVPLGITTVLTMSTIITGVNASMPRVSYIKAVDIYLWVSFVFVFLSVL
EYAAVNYLTTVQERKEQKLREKLPCTSGLPPPRTAMLDGNYSDGEVNDLDNYMPENGEKP
DRMMVQLTLASERSSPQRKSQRSSYVSMRIDTHAIDKYSRIIFPAAYILFNLIYWSIFS
NT seq 1440 nt   +upstreamnt  +downstreamnt
atgttggctgtcccaaatatgagatttggcatctttcttttgtggtggggatgggttttg
gccactgaaagcagaatgcactggcccggaagagaagtccacgagatgtctaagaaaggc
aggccccaaagacaaagacgagaagtacatgaagatgcccacaagcaagtcagcccaatt
ctgagacgaagtcctgacatcaccaaatcgcctctgacaaagtcagaacagcttctgagg
atagatgaccatgatttcagcatgaggcctggctttggaggccctgccattcctgttggt
gtggatgtgcaggtggagagtttggatagcatctcagaggttgacatggactttacgatg
accctctacctgaggcactactggaaggacgagaggctgtcttttccaagcaccaacaac
ctcagcatgacgtttgacggccggctggtcaagaagatctgggtccctgacatgtttttc
gtgcactccaaacgctccttcatccacgacaccaccacagacaacgtcatgttgcgggtc
cagcctgatgggaaagtgctctatagtctcagggttacagtaactgcaatgtgcaacatg
gacttcagccgatttcccttggacacacaaacgtgctctcttgaaattgaaagctatgcc
tatacagaagatgacctcatgctgtactggaaaaagggcaatgactccttaaagacagat
gaacggatctcactctcccagttcctcattcaggaattccacaccaccaccaaactggct
ttctacagcagcacaggctggtacaaccgtctctacattaatttcacgttgcgtcgccac
atcttcttcttcttgctccaaacttatttccccgctaccctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagccgtgcctgccagagtccccttaggtatcacaacg
gtgctgaccatgtccaccatcatcacgggcgtgaatgcctccatgccgcgcgtctcctac
atcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctctcggtgctg
gagtatgcggccgtcaactacctgaccactgtgcaggagaggaaggaacagaagctgcgg
gagaagcttccctgcaccagcggattacctccgccccgcactgcgatgctggacggcaac
tacagtgatggggaggtgaatgacctggacaactacatgccagagaatggagagaagccc
gacaggatgatggtgcagctgaccctggcctcagagaggagctccccacagaggaaaagt
cagagaagcagctatgtgagcatgagaatcgacacccacgccattgataaatactccagg
atcatctttccagcagcatacattttattcaatttaatatactggtctattttctcctag

KEGG   Homo sapiens (human): 2570
Entry
2570              CDS       T01001                                 

Gene name
GABRR2
Definition
(RefSeq) gamma-aminobutyric acid type A receptor subunit rho2
  KO
K05190  gamma-aminobutyric acid receptor subunit rho
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04723  Retrograde endocannabinoid signaling
hsa04727  GABAergic synapse
hsa05032  Morphine addiction
hsa05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2570 (GABRR2)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    2570 (GABRR2)
   04723 Retrograde endocannabinoid signaling
    2570 (GABRR2)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    2570 (GABRR2)
   05033 Nicotine addiction
    2570 (GABRR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    2570 (GABRR2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  GABA-A
   2570 (GABRR2)
SSDB
Motif
Pfam: Neur_chan_LBD Neur_chan_memb
Other DBs
NCBI-GeneID: 2570
NCBI-ProteinID: NP_002034
OMIM: 137162
HGNC: 4091
Ensembl: ENSG00000111886
Vega: OTTHUMG00000015198
Pharos: P28476(Tbio)
UniProt: P28476
LinkDB
Position
6q15
AA seq 465 aa
MPYFTRLILFLFCLMVLVESRKPKRKRWTGQVEMPKPSHLYKKNLDVTKIRKGKPQQLLR
VDEHDFSMRPAFGGPAIPVGVDVQVESLDSISEVDMDFTMTLYLRHYWKDERLAFSSASN
KSMTFDGRLVKKIWVPDVFFVHSKRSFTHDTTTDNIMLRVFPDGHVLYSMRITVTAMCNM
DFSHFPLDSQTCSLELESYAYTDEDLMLYWKNGDESLKTDEKISLSQFLIQKFHTTSRLA
FYSSTGWYNRLYINFTLRRHIFFFLLQTYFPATLMVMLSWVSFWIDRRAVPARVSLGITT
VLTMTTIITGVNASMPRVSYVKAVDIYLWVSFVFVFLSVLEYAAVNYLTTVQERKERKLR
EKFPCMCGMLHSKTMMLDGSYSESEANSLAGYPRSHILTEEERQDKIVVHLGLSGEANAA
RKKGLLKGQTGFRIFQNTHAIDKYSRLIFPASYIFFNLIYWSVFS
NT seq 1398 nt   +upstreamnt  +downstreamnt
atgccttattttacaagactcattttgttcttgttttgcttgatggttctcgtggagagc
agaaaacccaagaggaagcgatggacagggcaggtggaaatgcccaagccaagtcactta
tataagaagaaccttgatgtgaccaagatccggaagggaaagcctcagcagcttctcaga
gtggacgagcacgacttcagcatgagacccgccttcggaggccctgccatcccggtgggc
gtggacgtacaggtggagagcctggacagcatctccgaggtggacatggacttcactatg
accctgtacctgcggcattactggaaggatgagaggctagctttctccagcgccagcaac
aagagcatgaccttcgatggccggctggtgaagaagatctgggtccctgatgtcttcttt
gttcactccaaaagatcgttcactcatgacaccaccactgacaacatcatgctgagggtg
ttcccagatggacacgtgctgtacagcatgaggattacggtcactgccatgtgcaacatg
gacttcagccactttcccctggactcccagacctgttctttggagctggagagctatgcc
tatacagatgaagatctaatgctgtactggaagaatggggatgaatccctaaaaacagat
gagaagatctccttgtctcagtttctgattcagaaatttcacacaacttccaggctggcc
ttctacagcagcactggctggtacaaccgtctgtacattaacttcacgttgcgtcgccac
atcttcttcttcttgctccaaacatatttccctgccactctgatggtcatgctgtcctgg
gtgtccttctggatcgaccgcagagctgtgcctgccagagtttcactgggtatcacgacg
gtgctgaccatgaccaccatcatcacgggcgtgaatgcctccatgccgcgcgtctcctac
gtcaaggccgtggacatctacctctgggtcagctttgtgttcgtgttcctctcggtgctg
gagtatgcggctgtcaactacctgaccaccgtgcaggagcgcaaggaacggaagctgcgg
gagaagttcccgtgcatgtgtggaatgcttcattcaaaaaccatgatgctggatggaagc
tacagtgagtctgaggccaacagcctggctgggtaccccagaagccatatcctgacagaa
gaagaaaggcaagacaaaatagtggtccacctgggcctgagtggtgaagccaacgctgcc
agaaagaaggggcttctgaagggccagacgggttttcgtatcttccagaatacccatgcc
attgacaaatactctaggttgatattccctgcctcctacatatttttcaacttaatttat
tggtcagtgttttcctag

DBGET integrated database retrieval system