KEGG   Homo sapiens (human): 201514Help
Entry
201514            CDS       T01001                                 

Gene name
ZNF584
Definition
(RefSeq) zinc finger protein 584
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    201514 (ZNF584)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    201514 (ZNF584)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    201514 (ZNF584)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz zf_UBZ C1_1 zinc_ribbon_15 DUF3268 zf-C2H2_11 zf-LYAR zf-met Zn_Tnp_IS1595 zf-Di19 LIM
Motif
Other DBs
NCBI-GeneID: 201514
NCBI-ProteinID: NP_775819
HGNC: 27318
Ensembl: ENSG00000171574
Vega: OTTHUMG00000183533
Pharos: Q8IVC4(Tdark)
UniProt: Q8IVC4
LinkDB All DBs
Position
19q13.43
AA seq 421 aa AA seqDB search
MAGEAEAQLDPSLQGLVMFEDVTVYFSREEWGLLNVTQKGLYRDVMLENFALVSSLGLAP
SRSPVFTQLEDDEQSWVPSWVDVTPVSRAEARRGFGLDGLCRVEDERAHPEHLKSYRVIQ
HQDTHSEGKPRRHTEHGAAFPPGSSCGQQQEVHVAEKLFKCSDCGKVFLKAFALLDHLIT
HSEERPFRCPTGRSAFKKSAHINPRKIHTGETAHVCNECGKAFSYPSKLRKHQKVHTGIK
PFKCSDCGKTFNRKDALVLHQRIHTGERPYECSKCGKTFSVLSTLIRHRKVHIGERPYEC
TECGKFFKYNNSFILHQRVHTGERPFECKQCGKGYVTRSGLYQHWKVHTGERPYECSLCG
KTFTTRSYRNRHQQFHTEERSYECTECGKAFKHSSTLLQHKKVHTPERRQEDRAHGKVVS
C
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggccggggaggcggaggctcagttggacccatcattgcagggcttggtgatgtttgag
gatgtgacggtatatttctccagggaggagtgggggctccttaatgtgacccagaagggc
ctataccgggatgtgatgctggagaactttgcactcgttagctcactgggacttgcacct
tcgagatcccctgtgtttacccagctggaggatgatgaacagtcgtgggtgcccagctgg
gtggatgtgactccagtcagcagagcagaagccaggagaggttttggtcttgatggtttg
tgtagagtggaggatgagagagcccatcctgagcatctaaagagctacagagtcatccag
caccaggacactcatagtgaggggaaaccaagaaggcacactgagcatggggcagctttc
ccacctggttccagttgtgggcaacagcaagaagtccatgtggcagagaagctgttcaaa
tgcagtgactgtgggaaggtgttcttaaaggcctttgccctccttgaccatctgataacg
cattctgaagagagacccttcagatgcccaacaggcagaagtgctttcaagaagtcagct
catattaacccccgaaaaattcacactggagaaacagcccatgtgtgtaatgaatgtggg
aaggccttcagttacccgtctaagctgaggaaacaccagaaggttcacacaggcataaaa
ccttttaagtgtagtgactgtggtaaaaccttcaaccgcaaagacgcacttgttctacac
cagaggattcacactggagaaaggccttacgagtgcagcaaatgtggtaaaaccttcagt
gttctgtctaccctcattcggcaccggaaagtgcacattggagaaaggccctatgagtgt
acagaatgtgggaagttctttaaatacaataatagcttcattcttcaccagagagttcac
actggagaaaggccttttgaatgcaagcaatgtgggaaaggctacgtgacccgttcaggc
ctctatcagcactggaaagtccacactggggaacggccctatgaatgtagcctgtgtggg
aaaaccttcactaccagatcctaccgcaatcggcaccagcagttccacactgaagagagg
tcttatgaatgtacagagtgtgggaaggccttcaaacatagttccaccctccttcagcac
aagaaagtccatactccagaaaggcgtcaggaggacagggcacatgggaaggtcgttagc
tgctag

DBGET integrated database retrieval system