KEGG   Homo sapiens (human): 201595Help
Entry
201595            CDS       T01001                                 

Gene name
STT3B, CDG1X, SIMP, STT3-B
Definition
(RefSeq) STT3 oligosaccharyltransferase complex catalytic subunit B
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00655  STT3B deficiency in N-glycan precursor biosynthesis
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    201595 (STT3B)
   00513 Various types of N-glycan biosynthesis
    201595 (STT3B)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    201595 (STT3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    201595 (STT3B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     201595 (STT3B)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   201595 (STT3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STT3
Motif
Other DBs
NCBI-GeneID: 201595
NCBI-ProteinID: NP_849193
OMIM: 608605
HGNC: 30611
Ensembl: ENSG00000163527
Vega: OTTHUMG00000130673
Pharos: Q8TCJ2(Tbio)
UniProt: Q8TCJ2
LinkDB All DBs
Position
3p23
AA seq 826 aa AA seqDB search
MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSG
GLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIHEFDPWFNYRSTHHLASHGFY
EFLNWFDERAWYPLGRIVGGTVYPGLMITAGLIHWILNTLNITVHIRDVCVFLAPTFSGL
TSISTFLLTRELWNQGAGLLAACFIAIVPGYISRSVAGSFDNEGIAIFALQFTYYLWVKS
VKTGSVFWTMCCCLSYFYMVSAWGGYVFIINLIPLHVFVLLLMQRYSKRVYIAYSTFYIV
GLILSMQIPFVGFQPIRTSEHMAAAGVFALLQAYAFLQYLRDRLTKQEFQTLFFLGVSLA
AGAVFLSVIYLTYTGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQPTTWVSFFFDLHI
LVCTFPAGLWFCIKNINDERVFVALYAISAVYFAGVMVRLMLTLTPVVCMLSAIAFSNVF
EHYLGDDMKRENPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGPNIKSIVT
MLMLMLLMMFAVHCTWVTSNAYSSPSVVLASYNHDGTRNILDDFREAYFWLRQNTDEHAR
VMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNETAAYKIMRTLDVDYVLVI
FGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTPQGEFRVDKAGSPTLLNCLMYKM
SYYRFGEMQLDFRTPPGFDRTRNAEIGNKDIKFKHLEEAFTSEHWLVRIYKVKAPDNRET
LDHKPRVTNIFPKQKYLSKKTTKRKRGYIKNKLVFKKGKKISKKTV
NT seq 2481 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccctcggccccggagagcaagcacaagtcgtccctcaactcgtccccgtgg
agtggcctcatggccctgggaaacagccggcacggccaccacgggcccggggcccagtgc
gcgcacaaggcggcgggcggcgcggcgccgccgaagccggccccggcggggctgtccggg
gggctgtcgcagccggctgggtggcagtcgcttctctccttcaccatcctcttcctggcc
tggcttgccggcttcagctcgcgcctcttcgccgtcatccgcttcgaaagcatcatccac
gagttcgacccgtggtttaactatagatcaacacatcatcttgcatctcatgggttctat
gaatttttaaattggtttgatgaaagagcatggtatccactaggaagaatagtaggtggt
actgtttacccagggttgatgataaccgctggccttattcattggattttaaatacattg
aacataactgttcacataagagacgtatgtgtgttccttgcaccaacttttagcggcctt
acatctatatctactttcctgcttacaagagaactttggaaccaaggagcaggactttta
gctgcttgttttattgctattgtaccaggctacatatctcggtcagtagctggatccttt
gataatgaaggcattgctatttttgcacttcagttcacatactatttatgggtaaaatct
gtaaaaactgggtcagttttttggacaatgtgctgctgcttatcctatttctatatggtc
tctgcttggggtggttatgtatttatcatcaatcttattccactgcatgtatttgtgttg
ttactgatgcagagatacagcaaaagagtctacatagcatatagcactttctacattgtg
ggtttaatattatcaatgcagataccttttgtgggattccagccaatcagaacaagtgaa
cacatggcagctgcaggtgtctttgcattgctgcaagcttatgctttcttgcagtatctg
agagaccgattaacaaaacaagagttccagacccttttctttttgggtgtatcactagct
gcaggtgctgtgttccttagtgtcatctatttgacttatacaggttacattgcaccatgg
agtggcaggttttattcattgtgggatactgggtatgcaaaaatacacattccaattatt
gcatcagtgtctgagcatcaacctacgacttgggtgtctttcttctttgatctacatatt
cttgtatgtaccttcccagcaggcctttggttctgcatcaaaaatatcaacgatgaaaga
gtatttgttgctctatatgcaatcagtgctgtctactttgctggagtgatggtgcgactg
atgttgactttgactccagtcgtgtgtatgctgtctgcaattgccttttcaaatgttttt
gagcactatttgggggatgacatgaaaagggaaaatccacctgtggaggacagcagtgat
gaggatgacaaaagaaaccaaggaaatttgtatgataaggcaggtaaagtgaggaaacat
gcaactgaacaggaaaaaactgaagagggattaggccctaatataaaaagcattgtcacc
atgttgatgctgatgctattgatgatgtttgctgtccactgtacctgggtcacaagcaat
gcctactctagtccaagtgtagtcctggcctcatacaatcatgatggcaccaggaatatc
ttagatgattttagagaagcttacttttggctaaggcaaaatacagatgaacatgcacga
gtaatgtcttggtgggattatggctatcagatagctggaatggctaatagaactacgttg
gtggataataacacctggaataacagccacatagcactggtgggaaaagctatgtcttct
aatgaaacagcagcctataaaatcatgaggactctagatgtagattatgttttggttatt
tttggaggggttattggctattctggtgatgatatcaacaaatttctctggatggttagg
atagctgaaggagaacatcccaaagacattcgggaaagtgactattttaccccacaggga
gaattccgtgtagacaaagcaggatcccctactttgttgaattgccttatgtataaaatg
tcatactacagatttggagaaatgcagctggattttcgtacacccccaggttttgaccga
acacgtaatgctgagattggaaataaggacattaaattcaaacatttggaagaagccttt
acatcagaacactggcttgttaggatatataaagtaaaagcacctgataacagggagaca
ttagatcacaaacctcgagtcaccaacattttcccaaaacagaagtatttgtcaaagaag
actaccaaaaggaagcgtggctacattaaaaataagctggtttttaagaaaggcaagaaa
atatctaagaagactgtttaa

KEGG   Homo sapiens (human): 3703Help
Entry
3703              CDS       T01001                                 

Gene name
STT3A, ITM1, STT3-A, TMC
Definition
(RefSeq) STT3 oligosaccharyltransferase complex catalytic subunit A
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00654  STT3A deficiency in N-glycan precursor biosynthesis
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    3703 (STT3A)
   00513 Various types of N-glycan biosynthesis
    3703 (STT3A)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    3703 (STT3A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    3703 (STT3A)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     3703 (STT3A)
Glycosyltransferases [BR:hsa01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   3703 (STT3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: STT3 PMT_2 DUF2985
Motif
Other DBs
NCBI-GeneID: 3703
NCBI-ProteinID: NP_001265432
OMIM: 601134
HGNC: 6172
Ensembl: ENSG00000134910
Vega: OTTHUMG00000165852
Pharos: P46977(Tbio)
UniProt: P46977
LinkDB All DBs
Position
11q24.2
AA seq 705 aa AA seqDB search
MTKFGFLRLSYEKQDTLLKLLILSMAAVLSFSTRLFAVLRFESVIHEFDPYFNYRTTRFL
AEEGFYKFHNWFDDRAWYPLGRIIGGTIYPGLMITSAAIYHVLHFFHITIDIRNVCVFLA
PLFSSFTTIVTYHLTKELKDAGAGLLAAAMIAVVPGYISRSVAGSYDNEGIAIFCMLLTY
YMWIKAVKTGSICWAAKCALAYFYMVSSWGGYVFLINLIPLHVLVLMLTGRFSHRIYVAY
CTVYCLGTILSMQISFVGFQPVLSSEHMAAFGVFGLCQIHAFVDYLRSKLNPQQFEVLFR
SVISLVGFVLLTVGALLMLTGKISPWTGRFYSLLDPSYAKNNIPIIASVSEHQPTTWSSY
YFDLQLLVFMFPVGLYYCFSNLSDARIFIIMYGVTSMYFSAVMVRLMLVLAPVMCILSGI
GVSQVLSTYMKNLDISRPDKKSKKQQDSTYPIKNEVASGMILVMAFFLITYTFHSTWVTS
EAYSSPSIVLSARGGDGSRIIFDDFREAYYWLRHNTPEDAKVMSWWDYGYQITAMANRTI
LVDNNTWNNTHISRVGQAMASTEEKAYEIMRELDVSYVLVIFGGLTGYSSDDINKFLWMV
RIGGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGF
DRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRGLSRT
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgactaagtttggatttttgcgattgtcctatgagaagcaggacacacttttgaagctt
ctcattctgtcaatggctgctgtattatccttctccactcgtctgtttgctgtcctgaga
tttgaaagtgttatccatgagtttgatccgtactttaattatcggactaccaggttcctg
gctgaggaggggttttataaattccataactggtttgatgaccgagcctggtaccctttg
ggacgaatcattggaggaacaatttacccaggtttaatgatcacctctgctgcaatctac
catgtactccattttttccacatcaccatcgacattcggaatgtctgtgtgttcctggcc
cctctcttctcctccttcaccaccatcgtcacgtaccaccttaccaaagagctcaaggat
gcaggggctgggcttcttgctgctgccatgattgctgtagttcctggatatatctcccga
tctgtggctggctcctatgataatgaagggattgccatcttttgcatgctactcacctac
tacatgtggatcaaggcagtaaagactggttccatctgttgggcagctaagtgtgccctt
gcttatttctacatggtctcgtcatggggaggttatgtgttcctgatcaacttaattcct
ctccacgtcctcgtgctgatgctcacaggccgtttctctcaccggatctatgtggcctac
tgtactgtttactgcctgggcactatactttctatgcagatctcctttgtgggtttccag
cctgtcctttcatcagagcacatggcagcctttggggtctttggtctctgccagatccat
gcctttgtggattacctgcgcagcaagttgaatccacaacaatttgaagttcttttccgg
agcgtcatctctctggtaggctttgtccttctcaccgtgggagctctcctcatgctgaca
ggaaaaatatctccctggacggggcgtttctactcgctgctggatccctcttatgctaag
aacaacatccccatcattgcttctgtgtctgagcatcagcccacaacctggtcctcatac
tattttgacctgcagctcctcgtcttcatgtttccagttggcctctattactgctttagc
aacctgtctgatgcccggatttttatcatcatgtatggtgtgaccagcatgtacttttca
gctgtaatggtgcgtctaatgctagtgttggcacctgttatgtgcattctctctggcatt
ggagtctcccaggtgctgtccacatacatgaagaatctggacataagtcgtccagacaag
aagagcaagaagcaacaggattccacctaccctattaagaatgaagtggcaagtgggatg
atactggtcatggctttctttctcatcacctacacctttcattcaacctgggtgaccagt
gaggcctactcttctccgtccattgtactatctgcccgtggtggggatggcagtaggatc
atatttgatgacttccgagaagcatattattggcttcgtcataatactccagaggatgcg
aaggtcatgtcctggtgggattatggctatcagattacagctatggcaaaccgaacaatt
ttagtggacaataacacatggaataatacccatatttctcgagtagggcaggcaatggcg
tccacagaggaaaaagcctatgagatcatgagggagctcgatgtcagctatgtgctggtc
atttttggaggcctcactgggtattcctctgatgatatcaacaagtttctttggatggtc
cggattggagggagcacagatacaggcaaacatatcaaggagaatgactattatactcca
actggggagttccgtgtggaccgtgaaggttctccagtgctgctcaactgcctcatgtac
aagatgtgttactatcgctttggacaggtttacacagaagccaagcgtcctccaggcttt
gaccgtgtccgaaatgctgagattgggaataaagactttgagcttgatgtcctggaggaa
gcatataccacagaacattggctggtcaggatatacaaggtaaaggacctggataatcga
ggcttgtcaaggacataa

KEGG   Homo sapiens (human): 1603Help
Entry
1603              CDS       T01001                                 

Gene name
DAD1, OST2
Definition
(RefSeq) defender against cell death 1
  KO
K12668  oligosaccharyltransferase complex subunit epsilon
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    1603 (DAD1)
   00513 Various types of N-glycan biosynthesis
    1603 (DAD1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1603 (DAD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAD
Motif
Other DBs
NCBI-GeneID: 1603
NCBI-ProteinID: NP_001335
OMIM: 600243
HGNC: 2664
Ensembl: ENSG00000129562
Vega: OTTHUMG00000028685
Pharos: P61803(Tbio)
UniProt: P61803 Q53G02
LinkDB All DBs
Position
14q11.2
AA seq 113 aa AA seqDB search
MSASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGF
ISCVGSFILAVCLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcgtcggtagtgtctgtcatttcgcggttcttagaagagtacttgagctccact
ccgcagcgtctgaagttgctggacgcgtacctgctgtatatactgctgaccggggcgctg
cagttcggttactgtctcctcgtggggaccttccccttcaactcttttctctcgggcttc
atctcttgtgtggggagtttcatcctagcggtttgcctgagaatacagatcaacccacag
aacaaagcggatttccaaggcatctccccagagcgagcctttgctgattttctctttgcc
agcaccatcctgcaccttgttgtcatgaactttgttggctga

KEGG   Homo sapiens (human): 1650Help
Entry
1650              CDS       T01001                                 

Gene name
DDOST, AGER1, CDG1R, GATD6, OKSWcl45, OST, OST48, WBP1
Definition
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase non-catalytic subunit
  KO
K12670  oligosaccharyltransferase complex subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00656  DDOST deficiency in N-glycan precursor biosynthesis
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00118  Congenital disorders of glycosylation type I
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    1650 (DDOST)
   00513 Various types of N-glycan biosynthesis
    1650 (DDOST)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    1650 (DDOST)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DDOST_48kD
Motif
Other DBs
NCBI-GeneID: 1650
NCBI-ProteinID: NP_005207
OMIM: 602202
HGNC: 2728
Ensembl: ENSG00000244038
Vega: OTTHUMG00000002844
Pharos: P39656(Tchem)
UniProt: P39656 A0A024RAD5
LinkDB All DBs
Position
1p36.12
AA seq 456 aa AA seqDB search
MGYFRCAGAGSFGRRRKMEPSTAARAWALFWLLLPLLGAVCASGPRTLVLLDNLNVRETH
SLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFI
DGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENL
LKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKN
TLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVF
KEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRI
DPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYER
FIPSAYPYYASAFSMMLGLFIFSIVFLHMKEKEKSD
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atggggtacttccggtgtgcaggtgctgggtccttcggcaggaggaggaagatggagccc
agcaccgcggcccgggcttgggccctcttttggttgctgctgcccttgcttggcgcggtt
tgcgccagcggaccccgcaccttagtgctgctggacaacctcaacgtgcgggagactcat
tcgcttttcttccggagcctgaaggaccggggctttgagctcacattcaagaccgctgat
gaccccagcctgtctctcataaagtatggggaattcctctatgacaatctcatcattttc
tccccttcggtagaagattttggaggcaacatcaacgtggagaccatcagtgcctttatt
gacggcggaggcagtgtgctggtagctgccagctccgacattggtgaccctcttcgagag
ctgggcagtgagtgcgggattgagtttgacgaggagaaaacggctgtcattgaccatcac
aactatgacatctcagaccttggccagcatacgctcatcgtggctgacactgagaacctg
ctgaaggccccaaccatcgttgggaaatcatctctaaatcccatcctctttcgaggtgtt
gggatggtggccgatcctgataaccctttggtgctggacatcctgacgggctcttccacc
tcttactccttcttcccggacaagcctatcacccagtatccacatgcggtggggaagaac
accctcctcattgctgggctccaggccaggaacaatgcccgcgtcatcttcagcggctcc
ctcgacttcttcagcgactccttcttcaactcagcagtgcagaaggcggcgcccggctcc
cagaggtattcccagacaggcaactatgaactagctgtggccctctcccgctgggtgttc
aaggaggagggtgtcctccgtgtggggcctgtgtcccatcatcgggtgggcgagacagcc
ccacccaatgcctacactgtcactgacctagtggagtatagcatcgtgatccagcagctc
tcaaatggcaaatgggtcccctttgatggcgatgacattcagctggagtttgtccgcatt
gatccttttgtgaggaccttcctgaagaagaaaggtggcaaatacagtgttcagttcaag
ttgcccgacgtgtatggtgtattccagtttaaagtggattacaaccggctaggctacaca
cacctgtactcttccactcaggtatccgtgcggccactccagcacacgcagtatgagcgc
ttcatcccctcggcctacccctactacgccagcgccttctccatgatgctggggctcttc
atcttcagcatcgtcttcttgcacatgaaggagaaggagaagtccgactga

KEGG   Homo sapiens (human): 6184Help
Entry
6184              CDS       T01001                                 

Gene name
RPN1, OST1, RBPH1
Definition
(RefSeq) ribophorin I
  KO
K12666  oligosaccharyltransferase complex subunit alpha (ribophorin I)
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6184 (RPN1)
   00513 Various types of N-glycan biosynthesis
    6184 (RPN1)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6184 (RPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribophorin_I CtIP_N DNA_repr_REX1B FliD_C
Motif
Other DBs
NCBI-GeneID: 6184
NCBI-ProteinID: NP_002941
OMIM: 180470
HGNC: 10381
Ensembl: ENSG00000163902
Vega: OTTHUMG00000159691
Pharos: P04843(Tbio)
UniProt: P04843
LinkDB All DBs
Position
3q21.3
AA seq 607 aa AA seqDB search
MEAPAAGLFLLLLLGTWAPAPGSASSEAPPLINEDVKRTVDLSSHLAKVTAEVVLAHLGG
GSTSRATSFLLALEPELEARLAHLGVQVKGEDEEENNLEVRETKIKGKSGRFFTVKLPVA
LDPGAKISVIVETVYTHVLHPYPTQITQSEKQFVVFEGNHYFYSPYPTKTQTMRVKLASR
NVESYTKLGNPTRSEDLLDYGPFRDVPAYSQDTFKVHYENNSPFLTITSMTRVIEVSHWG
NIAVEENVDLKHTGAVLKGPFSRYDYQRQPDSGISSIRSFKTILPAAAQDVYYRDEIGNV
STSHLLILDDSVEMEIRPRFPLFGGWKTHYIVGYNLPSYEYLYNLGDQYALKMRFVDHVF
DEQVIDSLTVKIILPEGAKNIEIDSPYEISRAPDELHYTYLDTFGRPVIVAYKKNLVEQH
IQDIVVHYTFNKVLMLQEPLLVVAAFYILFFTVIIYVRLDFSITKDPAAEARMKVACITE
QVLTLVNKRIGLYRHFDETVNRYKQSRDISTLNSGKKSLETEHKALTSEIALLQSRLKTE
GSDLCDRVSEMQKLDAQVKELVLKSAVEAERLVAGKLKKDTYIENEKLISGKRQELVTKI
DHILDAL
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgccagccgccggcttgtttctgctcctgttgcttgggacttgggccccggcg
ccgggcagcgcctcctccgaggcaccgccgctgatcaatgaggacgtgaagcgcacagtg
gacctaagcagccacctggctaaggtgacggccgaggtggtcctggcgcacctgggcggc
ggctccacgtcccgagctacctctttcctgctggctttggagcctgagctcgaggcccgg
ctggcgcacctgggcgtgcaggtaaagggagaagatgaggaagagaacaatttggaagta
cgtgaaaccaaaattaagggtaaaagtgggagattcttcacagtcaagctcccagttgct
cttgatcctggggccaagatttcagtcattgtggaaacagtctacacccatgtgcttcat
ccgtatccaacccagatcacccagtcagagaaacagtttgtggtgtttgaggggaaccat
tatttctactctccctatccaacgaagacacaaaccatgcgtgtgaagcttgcctctcga
aatgtggagagctacaccaagctggggaaccccacgcgctctgaggacctactggattat
gggcctttcagagatgtgcctgcctatagtcaggatacttttaaagtacattatgagaac
aacagccctttcctgaccatcaccagcatgacccgagtcattgaagtctctcactggggt
aatattgctgtggaagaaaatgtggacttaaagcacacaggagctgtgcttaaggggcct
ttctcacgctatgattaccagagacagccagatagtggaatatcctccatccgttctttt
aagaccatccttcctgctgctgcccaggatgtttattaccgggatgagattggcaatgtt
tctaccagccacctccttattttggatgactctgtagagatggaaatccggcctcgcttc
cctctctttggcgggtggaagacccattacatcgttggctacaacctcccaagctatgag
tacctctataatttgggtgaccagtatgcactgaagatgaggtttgtggaccatgtgttt
gatgaacaagtgatagattctctgactgtgaagatcatcctgcctgaaggagccaagaac
attgaaattgatagtccctatgaaatcagccgtgccccagatgagctgcactacacctat
ctggacacatttggccgccctgtgattgttgcctacaagaaaaatctggtagaacagcac
attcaggacattgtggtccactacacgttcaacaaggtgctcatgctgcaggagcccctg
ctggtggtggcggccttctacatcctgttcttcaccgttatcatctatgttcggctggac
ttctccatcaccaaggatccagccgcagaagccaggatgaaggtagcctgcatcacagag
caggtcttgaccctggtcaacaagagaataggcctttaccgtcactttgacgagaccgtc
aataggtacaagcaatcccgggacatctccaccctcaacagtggcaagaagagcctggag
actgaacacaaggccttgaccagtgagattgcactgctgcagtccaggctgaagacagag
ggctctgatctgtgcgacagagtgagcgaaatgcagaagctggatgcacaggtcaaggag
ctggtgctgaagtcggcggtggaggctgagcgcctggtggctggcaagctcaagaaagac
acgtacattgagaatgagaagctcatctcaggaaagcgccaggagctggtcaccaagatc
gaccacatcctggatgccctgtag

KEGG   Homo sapiens (human): 6185Help
Entry
6185              CDS       T01001                                 

Gene name
RPN2, RIBIIR, RPN-II, RPNII, SWP1
Definition
(RefSeq) ribophorin II
  KO
K12667  oligosaccharyltransferase complex subunit delta (ribophorin II)
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    6185 (RPN2)
   00513 Various types of N-glycan biosynthesis
    6185 (RPN2)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    6185 (RPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribophorin_II DUF2922
Motif
Other DBs
NCBI-GeneID: 6185
NCBI-ProteinID: NP_002942
OMIM: 180490
HGNC: 10382
Ensembl: ENSG00000118705
Vega: OTTHUMG00000032409
Pharos: P04844(Tbio)
UniProt: P04844
LinkDB All DBs
Position
20q11.23
AA seq 631 aa AA seqDB search
MAPPGSSTVFLLALTIIASTWALTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSS
LGAQVPDAKKACTYIRSNLDPSNVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDS
SVTQIYHAVAALSGFGLPLASQEALSALTARLSKEETVLATVQALQTASHLSQQADLRSI
VEEIEDLVARLDELGGVYLQFEEGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAI
FSKKNFESLSEAFSVASAAAVLSHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPL
TQATVKLEHAKSVASRATVLQKTSFTPVGDVFELNFMNVKFSSGYYDFLVEVEGDNRYIA
NTVELRVKISTEVGITNVDLSTVDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQL
VDVNTGAELTPHQTFVRLHNQKTGQEVVFVAEPDNKNVYKFELDTSERKIEFDSASGTYT
LYLIIGDATLKNPILWNVADVVIKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTV
VSNTFTALILSPLLLLFALWIRIGANVSNFTFAPSTIIFHLGHAAMLGLMYVYWTQLNMF
QTLKYLAILGSVTFLAGNRMLAQQAVKRTAH
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgccgggttcaagcactgtcttcctgttggccctgacaatcatagccagcacc
tgggctctgacgcccactcactacctcaccaagcatgacgtggagagactaaaagcctcg
ctggatcgccctttcacaaatttggaatctgccttctactccatcgtgggactcagcagc
cttggtgctcaggtgccagatgcaaagaaagcatgtacctacatcagatctaaccttgat
cccagcaatgtggattccctcttctacgctgcccaggccagccaggccctctcaggatgt
gagatctctatttcaaatgagaccaaagatctgcttctggcagctgtcagtgaggactca
tctgttacccagatctaccatgcagttgcagctctaagtggctttggccttcccttggca
tcccaagaagcactcagtgcccttactgctcgtctcagcaaggaggagactgtgctggca
acagtccaggctctgcagacagcatcccacctgtcccagcaggctgacctgaggagcatc
gtggaggagattgaggaccttgttgctcgcctggatgaactcgggggcgtgtatctccag
tttgaagaaggactggaaacaacagcgttatttgtggctgccacctacaagctcatggat
catgtggggactgagccatccattaaggaggatcaggtcatccagctgatgaacgcgatc
ttcagcaagaagaactttgagtccctctccgaagccttcagcgtggcctctgcagctgct
gtgctctcgcataatcgctaccacgtgccagttgtggttgtgcctgagggctctgcttcc
gacactcatgaacaggctatcttgcggttgcaagtcaccaatgttctgtctcagcctctg
actcaggccactgttaaactagaacatgctaaatctgttgcttccagagccactgtcctc
cagaagacatccttcacccctgtaggggatgtttttgaactaaatttcatgaacgtcaaa
ttttccagtggttattatgacttccttgtcgaagttgaaggtgacaaccggtatattgca
aataccgtagagctcagagtcaagatctccactgaagttggcatcacaaatgttgatctt
tccaccgtggataaggatcagagcattgcacccaaaactacccgggtgacatacccagcc
aaagccaagggcacattcatcgcagacagccaccagaacttcgccttgttcttccagctg
gtagatgtgaacactggtgctgaactcactcctcaccagacatttgtccgactccataac
cagaagactggccaggaagtggtgtttgttgccgagccagacaacaagaacgtgtacaag
tttgaactggatacctctgaaagaaagattgaatttgactctgcctctggcacctacact
ctctacttaatcattggagatgccactttgaagaacccaatcctctggaatgtggctgat
gtggtcatcaagttccctgaggaagaagctccctcgactgtcttgtcccagaaccttttc
actccaaaacaggaaattcagcacctgttccgcgagcctgagaagaggccccccaccgtg
gtgtccaatacattcactgccctgatcctctcgccgttgcttctgctcttcgctctgtgg
atccggattggtgccaatgtctccaacttcacttttgctcctagcacgattatatttcac
ctgggacatgctgctatgctgggactcatgtatgtctactggactcagctcaacatgttc
cagaccttgaagtacctggccatcctgggcagtgtgacgtttctggctggcaatcggatg
ctggcccagcaggcagtcaagagaacagcacattag

KEGG   Homo sapiens (human): 7991Help
Entry
7991              CDS       T01001                                 

Gene name
TUSC3, D8S1992, M33, MRT22, MRT7, MagT2, N33, OST3A, SLC58A2
Definition
(RefSeq) tumor suppressor candidate 3
  KO
K12669  oligosaccharyltransferase complex subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa00510  N-Glycan biosynthesis
hsa00513  Various types of N-glycan biosynthesis
hsa01100  Metabolic pathways
hsa04141  Protein processing in endoplasmic reticulum
Module
hsa_M00072  N-glycosylation by oligosaccharyltransferase
Network
nt06015  N-Glycan biosynthesis
  Element
N00681  N-Glycan precursor biosynthesis, ALG6 to OST
Disease
H00768  Autosomal recessive mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    7991 (TUSC3)
   00513 Various types of N-glycan biosynthesis
    7991 (TUSC3)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7991 (TUSC3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7991 (TUSC3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC58: MagT-like magnesium transporter
   7991 (TUSC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OST3_OST6 Thioredoxin Gram_pos_anchor DUF4131
Motif
Other DBs
NCBI-GeneID: 7991
NCBI-ProteinID: NP_006756
OMIM: 601385
HGNC: 30242
Ensembl: ENSG00000104723
Vega: OTTHUMG00000094803
Pharos: Q13454(Tbio)
UniProt: Q13454
LinkDB All DBs
Structure
PDB: 

Position
8p22
AA seq 348 aa AA seqDB search
MGARGAPSRRRQAGRRLRYLPTGSFPFLLLLLLLCIQLGGGQKKKENLLAEKVEQLMEWS
SRRSIFRMNGDKFRKFIKAPPRNYSMIVMFTALQPQRQCSVCRQANEEYQILANSWRYSS
AFCNKLFFSMVDYDEGTDVFQQLNMNSAPTFMHFPPKGRPKRADTFDLQRIGFAAEQLAK
WIADRTDVHIRVFRPPNYSGTIALALLVSLVGGLLYLRRNNLEFIYNKTGWAMVSLCIVF
AMTSGQMWNHIRGPPYAHKNPHNGQVSYIHGSSQAQFVAESHIILVLNAAITMGMVLLNE
AATSKGDVGKRRIICLVGLGLVVFFFSFLLSIFRSKYHGYPYSDLDFE
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgggggcccggggcgctccttcacgccgtaggcaagcggggcggcggctgcggtacctg
cccaccgggagctttcccttccttctcctgctgctgctgctctgcatccagctcggggga
ggacagaagaaaaaggagaatcttttagctgaaaaagtagagcagctgatggaatggagt
tccagacgctcaatcttccgaatgaatggtgataaattccgaaaatttataaaggcacca
cctcgaaactattccatgattgttatgttcactgctcttcagcctcagcggcagtgttct
gtgtgcaggcaagctaatgaagaatatcaaatactggcgaactcctggcgctattcatct
gctttttgtaacaagctcttcttcagtatggtggactatgatgaggggacagacgttttt
cagcagctcaacatgaactctgctcctacattcatgcattttcctccaaaaggcagacct
aagagagctgatacttttgacctccaaagaattggatttgcagctgagcaactagcaaag
tggattgctgacagaacggatgttcatattcgggttttcagaccacccaactactctggt
accattgctttggccctgttagtgtcgcttgttggaggtttgctttatttgagaaggaac
aacttggagttcatctataacaagactggttgggccatggtgtctctgtgtatagtcttt
gctatgacttctggccagatgtggaaccatatccgtggacctccatatgctcataagaac
ccacacaatggacaagtgagctacattcatgggagcagccaggctcagtttgtggcagaa
tcacacattattctggtactgaatgccgctatcaccatggggatggttcttctaaatgaa
gcagcaacttcgaaaggcgatgttggaaaaagacggataatttgcctagtgggattgggc
ctggtggtcttcttcttcagttttctactttcaatatttcgttccaagtaccacggctat
ccttatagtgatctggactttgagtga

DBGET integrated database retrieval system