KEGG   Homo sapiens (human): 2021
Entry
2021              CDS       T01001                                 

Gene name
ENDOG
Definition
(RefSeq) endonuclease G
  KO
K01173  endonuclease G, mitochondrial
Organism
hsa  Homo sapiens (human)
Pathway
hsa04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    2021 (ENDOG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    2021 (ENDOG)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Mitochondrial DNA maintenance factors
    2021 (ENDOG)
SSDB
Motif
Pfam: Endonuclease_NS
Other DBs
NCBI-GeneID: 2021
NCBI-ProteinID: NP_004426
OMIM: 600440
HGNC: 3346
Ensembl: ENSG00000167136
Vega: OTTHUMG00000020763
Pharos: Q14249(Tbio)
UniProt: Q14249 E5KNL5
LinkDB
Position
9q34.11
AA seq 297 aa
MRALRAGLTLASGAGLGAVVEGWRRRREDARAAPGLLGRLPVLPVAAAAELPPVPGGPRG
PGELAKYGLPGLAQLKSRESYVLCYDPRTRGALWVVEQLRPERLRGDGDRRECDFREDDS
VHAYHRATNADYRGSGFDRGHLAAAANHRWSQKAMDDTFYLSNVAPQVPHLNQNAWNNLE
KYSRSLTRSYQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNHVAVPTHFFKVLILEAAGG
QIELRTYVMPNAPVDEAIPLERFLVPIESIERASGLLFVPNILARAGSLKAITAGSK
NT seq 894 nt   +upstreamnt  +downstreamnt
atgcgggcgctgcgggccggcctgaccctggcgtcgggcgcggggctgggtgcggtcgtc
gagggctggcggcggcggcgggaggacgcgcgggcggcgccgggactgctgggccggctg
cccgtgctgcccgtggcggcggcagccgagttgccccctgtgcccgggggaccccgcggc
ccgggcgagctggccaagtacgggctgccggggctggcgcagctcaagagccgcgagtcg
tacgtgctgtgctacgacccgcgcacccgcggcgcgctctgggtggtggagcagctgcga
cccgagcgtctccgcggcgacggcgaccggcgcgagtgcgacttccgcgaggacgactcg
gtgcacgcgtaccaccgtgccaccaacgccgactaccgcggcagtggcttcgaccgcggt
cacctggccgccgccgccaaccaccgctggagccagaaggccatggacgacacgttctac
ctgagcaacgtcgcgccccaggtgccccacctcaaccagaatgcctggaacaacctggag
aaatatagccgcagcttgacccgcagctaccaaaacgtctatgtctgcacagggccactc
ttcctgcccaggacagaggctgatgggaaatcctacgtaaagtaccaggtcatcggcaag
aaccacgtggcagtgcccacacacttcttcaaggtgctgatcctggaggcagcaggtggg
caaattgagctccgcacctacgtgatgcccaacgcacctgtggatgaggccatcccactg
gagcgcttcctggtgcccatcgagagcattgagcgggcttcggggctgctctttgtgcca
aacatcctggcgcgggcaggcagcctcaaggccatcacggcgggcagtaagtga

DBGET integrated database retrieval system