KEGG   Homo sapiens (human): 2047Help
Entry
2047              CDS       T01001                                 

Gene name
EPHB1, ELK, EPHT2, Hek6, NET
Definition
(RefSeq) EPH receptor B1
  KO
K05110  Eph receptor B1 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2047 (EPHB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2047 (EPHB1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2047 (EPHB1)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2047 (EPHB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N VSP Haspin_kinase ABC1 DAP10 cEGF EGF_2
Motif
Other DBs
NCBI-GeneID: 2047
NCBI-ProteinID: NP_004432
OMIM: 600600
HGNC: 3392
Ensembl: ENSG00000154928
Vega: OTTHUMG00000159804
Pharos: P54762(Tchem)
UniProt: P54762
LinkDB All DBs
Structure
PDB: 

Position
3q22.2
AA seq 984 aa AA seqDB search
MALDYLLLLLLASAVAAMEETLMDTRTATAELGWTANPASGWEEVSGYDENLNTIRTYQV
CNVFEPNQNNWLLTTFINRRGAHRIYTEMRFTVRDCSSLPNVPGSCKETFNLYYYETDSV
IATKKSAFWSEAPYLKVDTIAADESFSQVDFGGRLMKVNTEVRSFGPLTRNGFYLAFQDY
GACMSLLSVRVFFKKCPSIVQNFAVFPETMTGAESTSLVIARGTCIPNAEEVDVPIKLYC
NGDGEWMVPIGRCTCKPGYEPENSVACKACPAGTFKASQEAEGCSHCPSNSRSPAEASPI
CTCRTGYYRADFDPPEVACTSVPSGPRNVISIVNETSIILEWHPPRETGGRDDVTYNIIC
KKCRADRRSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPP
QHVSVNITTNQAAPSTVPIMHQVSATMRSITLSWPQPEQPNGIILDYEIRYYEKEHNEFN
SSMARSQTNTARIDGLRPGMVYVVQVRARTVAGYGKFSGKMCFQTLTDDDYKSELREQLP
LIAGSAAAGVVFVVSLVAISIVCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYIDPFTY
EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEK
QRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQ
LVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTS
SLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQD
YRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQ
PLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAG
HQKKILNSIHSMRVQISQSPTAMA
NT seq 2955 nt NT seq  +upstreamnt  +downstreamnt
atggccctggattatctactactgctcctcctggcatccgcagtggctgcgatggaagaa
acgttaatggacaccagaacggctactgcagagctgggctggacggccaatcctgcgtcc
gggtgggaagaagtcagtggctacgatgaaaacctgaacaccatccgcacctaccaggtg
tgcaatgtcttcgagcccaaccagaacaattggctgctcaccaccttcatcaaccggcgg
ggggcccatcgcatctacacagagatgcgcttcactgtgagagactgcagcagcctccct
aatgtcccaggatcctgcaaggagaccttcaacttgtattactatgagactgactctgtc
attgccaccaagaagtcagccttctggtctgaggccccctacctcaaagtagacaccatt
gctgcagatgagagcttctcccaggtggactttgggggaaggctgatgaaggtaaacaca
gaagtcaggagctttgggcctcttactcggaatggtttttacctcgcttttcaggattat
ggagcctgtatgtctcttctttctgtccgtgtcttcttcaaaaagtgtcccagcattgtg
caaaattttgcagtgtttccagagactatgacaggggcagagagcacatctctggtgatt
gctcggggcacatgcatccccaacgcagaggaagtggacgtgcccatcaaactctactgc
aacggggatggggaatggatggtgcctattgggcgatgcacctgcaagcctggctatgag
cctgagaacagcgtggcatgcaaggcttgccctgcagggacattcaaggccagccaggaa
gctgaaggctgctcccactgcccctccaacagccgctcccctgcagaggcgtctcccatc
tgcacctgtcggaccggttattaccgagcggactttgaccctccagaagtggcatgcact
agcgtcccatcaggtccccgcaatgttatctccatcgtcaatgagacgtccatcattctg
gagtggcaccctccaagggagacaggtgggcgggatgatgtgacctacaacatcatctgc
aaaaagtgccgggcagaccgccggagctgctcccgctgtgacgacaatgtggagtttgtg
cccaggcagctgggcctgacggagtgccgcgtctccatcagcagcctgtgggcccacacc
ccctacacctttgacatccaggccatcaatggagtctccagcaagagtcccttcccccca
cagcacgtctctgtcaacatcaccacaaaccaagccgccccctccaccgttcccatcatg
caccaagtcagtgccactatgaggagcatcaccttgtcatggccacagccggagcagccc
aatggcatcatcctggactatgagatccggtactatgagaaggaacacaatgagttcaac
tcctccatggccaggagtcagaccaacacagcaaggattgatgggctgcggcctggcatg
gtatatgtggtacaggtgcgtgcccgcactgttgctggctacggcaagttcagtggcaag
atgtgcttccagactctgactgacgatgattacaagtcagagctgagggagcagctgccc
ctgattgctggctcggcagcggccggggtcgtgttcgttgtgtccttggtggccatctct
atcgtctgtagcaggaaacgggcttatagcaaagaggctgtgtacagcgataagctccag
cattacagcacaggccgaggctccccagggatgaagatctacattgaccccttcacttac
gaggatcccaacgaagctgtccgggagtttgccaaggagattgatgtatcttttgtgaaa
attgaagaggtcatcggagcaggggagtttggagaagtgtacaaggggcgtttgaaactg
ccaggcaagagggaaatctacgtggccatcaagaccctgaaggcagggtactcggagaag
cagcgtcgggactttctgagtgaggcgagcatcatgggccagttcgaccatcctaacatc
attcgcctggagggtgtggtcaccaagagtcggcctgtcatgatcatcacagagttcatg
gagaatggtgcattggattctttcctcaggcaaaatgacgggcagttcaccgtgatccag
cttgtgggtatgctcaggggcatcgctgctggcatgaagtacctggctgagatgaattat
gtgcatcgggacctggctgctaggaacattctggtcaacagtaacctggtgtgcaaggtg
tccgactttggcctctcccgctacctccaggatgacacctcagatcccacctacaccagc
tccttgggagggaagatccctgtgagatggacagctccagaggccatcgcctaccgcaag
ttcacttcagccagcgacgtttggagctatgggatcgtcatgtgggaagtcatgtcattt
ggagagagaccctattgggatatgtccaaccaagatgtcatcaatgccatcgagcaggac
taccggctgcccccacccatggactgtccagctgctctacaccagctcatgctggactgt
tggcagaaggaccggaacagccggccccggtttgcggagattgtcaacaccctagataag
atgatccggaacccggcaagtctcaagactgtggcaaccatcaccgccgtgccttcccag
cccctgctcgaccgctccatcccagacttcacggcctttaccaccgtggatgactggctc
agcgccatcaaaatggtccagtacagggacagcttcctcactgctggcttcacctccctc
cagctggtcacccagatgacatcagaagacctcctgagaataggcatcaccttggcaggc
catcagaagaagatcctgaacagcattcattctatgagggtccagataagtcagtcacca
acggcaatggcatga

KEGG   Homo sapiens (human): 2048Help
Entry
2048              CDS       T01001                                 

Gene name
EPHB2, BDPLT22, CAPB, DRT, EK5, EPHT3, ERK, Hek5, PCBC, Tyro5
Definition
(RefSeq) EPH receptor B2
  KO
K05111  Eph receptor B2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Drug target
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2048 (EPHB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2048 (EPHB2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2048 (EPHB2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2048 (EPHB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N SusE cEGF Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 2048
NCBI-ProteinID: NP_001296122
OMIM: 600997
HGNC: 3393
Ensembl: ENSG00000133216
Vega: OTTHUMG00000002881
Pharos: P29323(Tchem)
UniProt: P29323 Q6NVW1 Q4LE53
LinkDB All DBs
Structure
PDB: 

Position
1p36.12
AA seq 1055 aa AA seqDB search
MALRRLGAALLLLPLLAAVEETLMDSTTATAELGWMVHPPSGWEEVSGYDENMNTIRTYQ
VCNVFESSQNNWLRTKFIRRRGAHRIHVEMKFSVRDCSSIPSVPGSCKETFNLYYYEADF
DSATKTFPNWMENPWVKVDTIAADESFSQVDLGGRVMKINTEVRSFGPVSRSGFYLAFQD
YGGCMSLIAVRVFYRKCPRIIQNGAIFQETLSGAESTSLVAARGSCIANAEEVDVPIKLY
CNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGA
TNCVCRNGYYRADLDPLDMPCTTIPSAPQAVISSVNETSLMLEWTPPRDSGGREDLVYNI
ICKSCGSGRGACTRCGDNVQYAPRQLGLTEPRIYISDLLAHTQYTFEIQAVNGVTDQSPF
SPQFASVNITTNQAAPSAVSIMHQVSRTVDSITLSWSQPDQPNGVILDYELQYYEKELSE
YNATAIKSPTNTVTVQGLKAGAIYVFQVRARTVAGYGRYSGKMYFQTMTEAEYQTSIQEK
LPLIIGSSAAGLVFLIAVVVIAIVCNRRGFERADSEYTDKLQHYTSGHMTPGMKIYIDPF
TYEDPNEAVREFAKEIDISCVKIEQVIGAGEFGEVCSGHLKLPGKREIFVAIKTLKSGYT
EKQRRDFLSEASIMGQFDHPNVIHLEGVVTKSTPVMIITEFMENGSLDSFLRQNDGQFTV
IQLVGMLRGIAAGMKYLADMNYVHRDLAARNILVNSNLVCKVSDFGLSRFLEDDTSDPTY
TSALGGKIPIRWTAPEAIQYRKFTSASDVWSYGIVMWEVMSYGERPYWDMTNQDVINAIE
QDYRLPPPMDCPSALHQLMLDCWQKDRNHRPKFGQIVNTLDKMIRNPNSLKAMAPLSSGI
NLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTL
AGHQKKILNSIQVMRAQMNQIQSVEGQPLARRPRATGRTKRCQPRDVTKKTCNSNDGKKK
GMGKKKTDPGRGREIQGIFFKEDSHKESNDCSCGG
NT seq 3168 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcggaggctgggggccgcgctgctgctgctgccgctgctcgccgccgtggaa
gaaacgctaatggactccactacagcgactgctgagctgggctggatggtgcatcctcca
tcagggtgggaagaggtgagtggctacgatgagaacatgaacacgatccgcacgtaccag
gtgtgcaacgtgtttgagtcaagccagaacaactggctacggaccaagtttatccggcgc
cgtggcgcccaccgcatccacgtggagatgaagttttcggtgcgtgactgcagcagcatc
cccagcgtgcctggctcctgcaaggagaccttcaacctctattactatgaggctgacttt
gactcggccaccaagaccttccccaactggatggagaatccatgggtgaaggtggatacc
attgcagccgacgagagcttctcccaggtggacctgggtggccgcgtcatgaaaatcaac
accgaggtgcggagcttcggacctgtgtcccgcagcggcttctacctggccttccaggac
tatggcggctgcatgtccctcatcgccgtgcgtgtcttctaccgcaagtgcccccgcatc
atccagaatggcgccatcttccaggaaaccctgtcgggggctgagagcacatcgctggtg
gctgcccggggcagctgcatcgccaatgcggaagaggtggatgtacccatcaagctctac
tgtaacggggacggcgagtggctggtgcccatcgggcgctgcatgtgcaaagcaggcttc
gaggccgttgagaatggcaccgtctgccgaggttgtccatctgggactttcaaggccaac
caaggggatgaggcctgtacccactgtcccatcaacagccggaccacttctgaaggggcc
accaactgtgtctgccgcaatggctactacagagcagacctggaccccctggacatgccc
tgcacaaccatcccctccgcgccccaggctgtgatttccagtgtcaatgagacctccctc
atgctggagtggacccctccccgcgactccggaggccgagaggacctcgtctacaacatc
atctgcaagagctgtggctcgggccggggtgcctgcacccgctgcggggacaatgtacag
tacgcaccacgccagctaggcctgaccgagccacgcatttacatcagtgacctgctggcc
cacacccagtacaccttcgagatccaggctgtgaacggcgttactgaccagagccccttc
tcgcctcagttcgcctctgtgaacatcaccaccaaccaggcagctccatcggcagtgtcc
atcatgcatcaggtgagccgcaccgtggacagcattaccctgtcgtggtcccagccggac
cagcccaatggcgtgatcctggactatgagctgcagtactatgagaaggagctcagtgag
tacaacgccacagccataaaaagccccaccaacacggtcaccgtgcagggcctcaaagcc
ggcgccatctatgtcttccaggtgcgggcacgcaccgtggcaggttacgggcgctacagc
ggcaagatgtacttccagaccatgacagaagccgagtaccagacaagcatccaggagaag
ttgccactcatcatcggctcctcggccgctggcctggtcttcctcattgctgtggttgtc
atcgccatcgtgtgtaacagacgggggtttgagcgtgctgactcggagtacacggacaag
ctgcaacactacaccagtggccacatgaccccaggcatgaagatctacatcgatcctttc
acctacgaggaccccaacgaggcagtgcgggagtttgccaaggaaattgacatctcctgt
gtcaaaattgagcaggtgatcggagcaggggagtttggcgaggtctgcagtggccacctg
aagctgccaggcaagagagagatctttgtggccatcaagacgctcaagtcgggctacacg
gagaagcagcgccgggacttcctgagcgaagcctccatcatgggccagttcgaccatccc
aacgtcatccacctggagggtgtcgtgaccaagagcacacctgtgatgatcatcaccgag
ttcatggagaatggctccctggactcctttctccggcaaaacgatgggcagttcacagtc
atccagctggtgggcatgcttcggggcatcgcagctggcatgaagtacctggcagacatg
aactatgttcaccgtgacctggctgcccgcaacatcctcgtcaacagcaacctggtctgc
aaggtgtcggactttgggctctcacgctttctagaggacgatacctcagaccccacctac
accagtgccctgggcggaaagatccccatccgctggacagccccggaagccatccagtac
cggaagttcacctcggccagtgatgtgtggagctacggcattgtcatgtgggaggtgatg
tcctatggggagcggccctactgggacatgaccaaccaggatgtaatcaatgccattgag
caggactatcggctgccaccgcccatggactgcccgagcgccctgcaccaactcatgctg
gactgttggcagaaggaccgcaaccaccggcccaagttcggccaaattgtcaacacgcta
gacaagatgatccgcaatcccaacagcctcaaagccatggcgcccctctcctctggcatc
aacctgccgctgctggaccgcacgatccccgactacaccagctttaacacggtggacgag
tggctggaggccatcaagatggggcagtacaaggagagcttcgccaatgccggcttcacc
tcctttgacgtcgtgtctcagatgatgatggaggacattctccgggttggggtcactttg
gctggccaccagaaaaaaatcctgaacagtatccaggtgatgcgggcgcagatgaaccag
attcagtctgtggagggccagccactcgccaggaggccacgggccacgggaagaaccaag
cggtgccagccacgagacgtcaccaagaaaacatgcaactcaaacgacggaaaaaaaaag
ggaatgggaaaaaagaaaacagatcctgggagggggcgggaaatacaaggaatatttttt
aaagaggattctcataaggaaagcaatgactgttcttgcgggggataa

KEGG   Homo sapiens (human): 2049Help
Entry
2049              CDS       T01001                                 

Gene name
EPHB3, EK2, ETK2, HEK2, TYRO6
Definition
(RefSeq) EPH receptor B3
  KO
K05112  Eph receptor B3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2049 (EPHB3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2049 (EPHB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2049 (EPHB3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2049 (EPHB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_1 EphA2_TM SAM_2 Ephrin_rec_like Pur_ac_phosph_N Interfer-bind Cadherin_C_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2049
NCBI-ProteinID: NP_004434
OMIM: 601839
HGNC: 3394
Ensembl: ENSG00000182580
Vega: OTTHUMG00000156710
Pharos: P54753(Tchem)
UniProt: P54753
LinkDB All DBs
Structure
PDB: 

Position
3q27.1
AA seq 998 aa AA seqDB search
MARARPPPPPSPPPGLLPLLPPLLLLPLLLLPAGCRALEETLMDTKWVTSELAWTSHPES
GWEEVSGYDEAMNPIRTYQVCNVRESSQNNWLRTGFIWRRDVQRVYVELKFTVRDCNSIP
NIPGSCKETFNLFYYEADSDVASASSPFWMENPYVKVDTIAPDESFSRLDAGRVNTKVRS
FGPLSKAGFYLAFQDQGACMSLISVRAFYKKCASTTAGFALFPETLTGAEPTSLVIAPGT
CIPNAVEVSVPLKLYCNGDGEWMVPVGACTCATGHEPAAKESQCRPCPPGSYKAKQGEGP
CLPCPPNSRTTSPAASICTCHNNFYRADSDSADSACTTVPSPPRGVISNVNETSLILEWS
EPRDLGGRDDLLYNVICKKCHGAGGASACSRCDDNVEFVPRQLGLTERRVHISHLLAHTR
YTFEVQAVNGVSGKSPLPPRYAAVNITTNQAAPSEVPTLRLHSSSGSSLTLSWAPPERPN
GVILDYEMKYFEKSEGIASTVTSQMNSVQLDGLRPDARYVVQVRARTVAGYGQYSRPAEF
ETTSERGSGAQQLQEQLPLIVGSATAGLVFVVAVVVIAIVCLRKQRHGSDSEYTEKLQQY
IAPGMKVYIDPFTYEDPNEAVREFAKEIDVSCVKIEEVIGAGEFGEVCRGRLKQPGRREV
FVAIKTLKVGYTERQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMILTEFMENCALD
SFLRLNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNILVNSNLVCKVSDFGLS
RFLEDDPSDPTYTSSLGGKIPIRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSYGERPYW
DMSNQDVINAVEQDYRLPPPMDCPTALHQLMLDCWVRDRNLRPKFSQIVNTLDKLIRNAA
SLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQM
TAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQV
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggccagagcccgcccgccgccgccgccgtcgccgccgccggggcttctgccgctgctc
cctccgctgctgctgctgccgctgctgctgctgcccgccggctgccgggcgctggaagag
accctcatggacacaaaatgggtaacatctgagttggcgtggacatctcatccagaaagt
gggtgggaagaggtgagtggctacgatgaggccatgaatcccatccgcacataccaggtg
tgtaatgtgcgcgagtcaagccagaacaactggcttcgcacggggttcatctggcggcgg
gatgtgcagcgggtctacgtggagctcaagttcactgtgcgtgactgcaacagcatcccc
aacatccccggctcctgcaaggagaccttcaacctcttctactacgaggctgacagcgat
gtggcctcagcctcctcccccttctggatggagaacccctacgtgaaagtggacaccatt
gcacccgatgagagcttctcgcggctggatgccggccgtgtcaacaccaaggtgcgcagc
tttgggccactttccaaggctggcttctacctggccttccaggaccagggcgcctgcatg
tcgctcatctccgtgcgcgccttctacaagaagtgtgcatccaccaccgcaggcttcgca
ctcttccccgagaccctcactggggcggagcccacctcgctggtcattgctcctggcacc
tgcatccctaacgccgtggaggtgtcggtgccactcaagctctactgcaacggcgatggg
gagtggatggtgcctgtgggtgcctgcacctgtgccaccggccatgagccagctgccaag
gagtcccagtgccgcccctgtccccctgggagctacaaggcgaagcagggagaggggccc
tgcctcccatgtccccccaacagccgtaccacctccccagccgccagcatctgcacctgc
cacaataacttctaccgtgcagactcggactctgcggacagtgcctgtaccaccgtgcca
tctccaccccgaggtgtgatctccaatgtgaatgaaacctcactgatcctcgagtggagt
gagccccgggacctgggtggccgggatgacctcctgtacaatgtcatctgcaagaagtgc
catggggctggaggggcctcagcctgctcacgctgtgatgacaacgtggagtttgtgcct
cggcagctgggcctgacggagcgccgggtccacatcagccatctgctggcccacacgcgc
tacacctttgaggtgcaggcggtcaacggtgtctcgggcaagagccctctgccgcctcgt
tatgcggccgtgaatatcaccacaaaccaggctgccccgtctgaagtgcccacactacgc
ctgcacagcagctcaggcagcagcctcaccctatcctgggcacccccagagcggcccaac
ggagtcatcctggactacgagatgaagtactttgagaagagcgagggcatcgcctccaca
gtgaccagccagatgaactccgtgcagctggacgggcttcggcctgacgcccgctatgtg
gtccaggtccgtgcccgcacagtagctggctatgggcagtacagccgccctgccgagttt
gagaccacaagtgagagaggctctggggcccagcagctccaggagcagcttcccctcatc
gtgggctccgctacagctgggcttgtcttcgtggtggctgtcgtggtcatcgctatcgtc
tgcctcaggaagcagcgacacggctctgattcggagtacacggagaagctgcagcagtac
attgctcctggaatgaaggtttatattgacccttttacctacgaggaccctaatgaggct
gttcgggagtttgccaaggagatcgacgtgtcctgcgtcaagatcgaggaggtgatcgga
gctggggaatttggggaagtgtgccgtggtcgactgaaacagcctggccgccgagaggtg
tttgtggccatcaagacgctgaaggtgggctacaccgagaggcagcggcgggacttccta
agcgaggcctccatcatgggtcagtttgatcaccccaatataatccggctcgagggcgtg
gtcaccaaaagtcggccagttatgatcctcactgagttcatggaaaactgcgccctggac
tccttcctccggctcaacgatgggcagttcacggtcatccagctggtgggcatgttgcgg
ggcattgctgccggcatgaagtacctgtccgagatgaactatgtgcaccgcgacctggct
gctcgcaacatccttgtcaacagcaacctggtctgcaaagtctcagactttggcctctcc
cgcttcctggaggatgacccctccgatcctacctacaccagttccctgggcgggaagatc
cccatccgctggactgccccagaggccatagcctatcggaagttcacttctgctagtgat
gtctggagctacggaattgtcatgtgggaggtcatgagctatggagagcgaccctactgg
gacatgagcaaccaggatgtcatcaatgccgtggagcaggattaccggctgccaccaccc
atggactgtcccacagcactgcaccagctcatgctggactgctgggtgcgggaccggaac
ctcaggcccaaattctcccagattgtcaataccctggacaagctcatccgcaatgctgcc
agcctcaaggtcattgccagcgctcagtctggcatgtcacagcccctcctggaccgcacg
gtcccagattacacaaccttcacgacagttggtgattggctggatgccatcaagatgggg
cggtacaaggagagcttcgtcagtgcggggtttgcatcttttgacctggtggcccagatg
acggcagaagacctgctccgtattggggtcaccctggccggccaccagaagaagatcctg
agcagtatccaggacatgcggctgcagatgaaccagacgctgcctgtgcaggtctga

KEGG   Homo sapiens (human): 2050Help
Entry
2050              CDS       T01001                                 

Gene name
EPHB4, CMAVM2, HFASD, HTK, LMPHM7, MYK1, TYRO11
Definition
(RefSeq) EPH receptor B4
  KO
K05113  Eph receptor B4 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Disease
H02043  Capillary malformation-arteriovenous malformation
Drug target
Sitravatinib (DG03045): D11140 D11541
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2050 (EPHB4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2050 (EPHB4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2050 (EPHB4)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2050 (EPHB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 EphA2_TM SAM_1 SAM_2 Ephrin_rec_like Pur_ac_phosph_N Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 2050
NCBI-ProteinID: NP_004435
OMIM: 600011
HGNC: 3395
Ensembl: ENSG00000196411
Vega: OTTHUMG00000157040
Pharos: P54760(Tchem)
UniProt: P54760 Q96L35 Q541P7
LinkDB All DBs
Structure
PDB: 

Position
7q22.1
AA seq 987 aa AA seqDB search
MELRVLLCWASLAAALEETLLNTKLETADLKWVTFPQVDGQWEELSGLDEEQHSVRTYEV
CDVQRAPGQAHWLRTGWVPRRGAVHVYATLRFTMLECLSLPRAGRSCKETFTVFYYESDA
DTATALTPAWMENPYIKVDTVAAEHLTRKRPGAEATGKVNVKTLRLGPLSKAGFYLAFQD
QGACMALLSLHLFYKKCAQLTVNLTRFPETVPRELVVPVAGSCVVDAVPAPGPSPSLYCR
EDGQWAEQPVTGCSCAPGFEAAEGNTKCRACAQGTFKPLSGEGSCQPCPANSHSNTIGSA
VCQCRVGYFRARTDPRGAPCTTPPSAPRSVVSRLNGSSLHLEWSAPLESGGREDLTYALR
CRECRPGGSCAPCGGDLTFDPGPRDLVEPWVVVRGLRPDFTYTFEVTALNGVSSLATGPV
PFEPVNVTTDREVPPAVSDIRVTRSSPSSLSLAWAVPRAPSGAVLDYEVKYHEKGAEGPS
SVRFLKTSENRAELRGLKRGASYLVQVRARSEAGYGPFGQEHHSQTQLDESEGWREQLAL
IAGTAVVGVVLVLVVIVVAVLCLRKQSNGREAEYSDKHGQYLIGHGTKVYIDPFTYEDPN
EAVREFAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLKGGYTERQRRE
FLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGM
LRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFGLSRFLEENSSDPTYTSSLGG
KIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLP
PPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLKIVARENGGASHPLLD
QRQPHYSAFGSVGEWLRAIKMGRYEESFAAAGFGSFELVSQISAEDLLRIGVTLAGHQKK
ILASVQHMKSQAKPGTPGGTGGPAPQY
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggagctccgggtgctgctctgctgggcttcgttggccgcagctttggaagagaccctg
ctgaacacaaaattggaaactgctgatctgaagtgggtgacattccctcaggtggacggg
cagtgggaggaactgagcggcctggatgaggaacagcacagcgtgcgcacctacgaagtg
tgtgacgtgcagcgtgccccgggccaggcccactggcttcgcacaggttgggtcccacgg
cggggcgccgtccacgtgtacgccacgctgcgcttcaccatgctcgagtgcctgtccctg
cctcgggctgggcgctcctgcaaggagaccttcaccgtcttctactatgagagcgatgcg
gacacggccacggccctcacgccagcctggatggagaacccctacatcaaggtggacacg
gtggccgcggagcatctcacccggaagcgccctggggccgaggccaccgggaaggtgaat
gtcaagacgctgcgtctgggaccgctcagcaaggctggcttctacctggccttccaggac
cagggtgcctgcatggccctgctatccctgcacctcttctacaaaaagtgcgcccagctg
actgtgaacctgactcgattcccggagactgtgcctcgggagctggttgtgcccgtggcc
ggtagctgcgtggtggatgccgtccccgcccctggccccagccccagcctctactgccgt
gaggatggccagtgggccgaacagccggtcacgggctgcagctgtgctccggggttcgag
gcagctgaggggaacaccaagtgccgagcctgtgcccagggcaccttcaagcccctgtca
ggagaagggtcctgccagccatgcccagccaatagccactctaacaccattggatcagcc
gtctgccagtgccgcgtcgggtacttccgggcacgcacagacccccggggtgcaccctgc
accacccctccttcggctccgcggagcgtggtttcccgcctgaacggctcctccctgcac
ctggaatggagtgcccccctggagtctggtggccgagaggacctcacctacgccctccgc
tgccgggagtgccgacccggaggctcctgtgcgccctgcgggggagacctgacttttgac
cccggcccccgggacctggtggagccctgggtggtggttcgagggctacgtcctgacttc
acctatacctttgaggtcactgcattgaacggggtatcctccttagccacggggcccgtc
ccatttgagcctgtcaatgtcaccactgaccgagaggtacctcctgcagtgtctgacatc
cgggtgacgcggtcctcacccagcagcttgagcctggcctgggctgttccccgggcaccc
agtggggctgtgctggactacgaggtcaaataccatgagaagggcgccgagggtcccagc
agcgtgcggttcctgaagacgtcagaaaaccgggcagagctgcgggggctgaagcgggga
gccagctacctggtgcaggtacgggcgcgctctgaggccggctacgggcccttcggccag
gaacatcacagccagacccaactggatgagagcgagggctggcgggagcagctggccctg
attgcgggcacggcagtcgtgggtgtggtcctggtcctggtggtcattgtggtcgcagtt
ctctgcctcaggaagcagagcaatgggagagaagcagaatattcggacaaacacggacag
tatctcatcggacatggtactaaggtctacatcgaccccttcacttatgaagaccctaat
gaggctgtgagggaatttgcaaaagagatcgatgtctcctacgtcaagattgaagaggtg
attggtgcaggtgagtttggcgaggtgtgccgggggcggctcaaggccccagggaagaag
gagagctgtgtggcaatcaagaccctgaagggtggctacacggagcggcagcggcgtgag
tttctgagcgaggcctccatcatgggccagttcgagcaccccaatatcatccgcctggag
ggcgtggtcaccaacagcatgcccgtcatgattctcacagagttcatggagaacggcgcc
ctggactccttcctgcggctaaacgacggacagttcacagtcatccagctcgtgggcatg
ctgcggggcatcgcctcgggcatgcggtaccttgccgagatgagctacgtccaccgagac
ctggctgctcgcaacatcctagtcaacagcaacctcgtctgcaaagtgtctgactttggc
ctttcccgattcctggaggagaactcttccgatcccacctacacgagctccctgggagga
aagattcccatccgatggactgccccggaggccattgccttccggaagttcacttccgcc
agtgatgcctggagttacgggattgtgatgtgggaggtgatgtcatttggggagaggccg
tactgggacatgagcaatcaggacgtgatcaatgccattgaacaggactaccggctgccc
ccgcccccagactgtcccacctccctccaccagctcatgctggactgttggcagaaagac
cggaatgcccggccccgcttcccccaggtggtcagcgccctggacaagatgatccggaac
cccgccagcctcaaaatcgtggcccgggagaatggcggggcctcacaccctctcctggac
cagcggcagcctcactactcagcttttggctctgtgggcgagtggcttcgggccatcaaa
atgggaagatacgaagaaagtttcgcagccgctggctttggctccttcgagctggtcagc
cagatctctgctgaggacctgctccgaatcggagtcactctggcgggacaccagaagaaa
atcttggccagtgtccagcacatgaagtcccaggccaagccgggaaccccgggtgggaca
ggaggaccggccccgcagtactga

KEGG   Homo sapiens (human): 2051Help
Entry
2051              CDS       T01001                                 

Gene name
EPHB6, HEP
Definition
(RefSeq) EPH receptor B6
  KO
K05114  Eph receptor B6 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2051 (EPHB6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2051 (EPHB6)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2051 (EPHB6)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EPH family [OT]
   2051 (EPHB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Ephrin_lbd Pkinase fn3 SAM_2 EphA2_TM SAM_1 Ephrin_rec_like Pur_ac_phosph_N Phage_holin_5_1
Motif
Other DBs
NCBI-GeneID: 2051
NCBI-ProteinID: NP_004436
OMIM: 602757
HGNC: 3396
Ensembl: ENSG00000106123
Vega: OTTHUMG00000155707
Pharos: O15197(Tchem)
UniProt: O15197 F8WCM8
LinkDB All DBs
Position
7q34
AA seq 1022 aa AA seqDB search
MATEGAAQLGNRVAGMVCSLWVLLLVSSVLALEEVLLDTTGETSEIGWLTYPPGGWDEVS
VLDDQRRLTRTFEACHVAGAPPGTGQDNWLQTHFVERRGAQRAHIRLHFSVRACSSLGVS
GGTCRETFTLYYRQAEEPDSPDSVSSWHLKRWTKVDTIAADESFPSSSSSSSSSSSSAAW
AVGPHGAGQRAGLQLNVKERSFGPLTQRGFYVAFQDTGACLALVAVRLFSYTCPAVLRSF
ASFPETQASGAGGASLVAAVGTCVAHAEPEEDGVGGQAGGSPPRLHCNGEGKWMVAVGGC
RCQPGYQPARGDKACQACPRGLYKASAGNAPCSPCPARSHAPNPAAPVCPCLEGFYRASS
DPPEAPCTGPPSAPQELWFEVQGSALMLHWRLPRELGGRGDLLFNVVCKECEGRQEPASG
GGGTCHRCRDEVHFDPRQRGLTESRVLVGGLRAHVPYILEVQAVNGVSELSPDPPQAAAI
NVSTSHEVPSAVPVVHQVSRASNSITVSWPQPDQTNGNILDYQLRYYDQAEDESHSFTLT
SETNTATVTQLSPGHIYGFQVRARTAAGHGPYGGKVYFQTLPQGELSSQLPERLSLVIGS
ILGALAFLLLAAITVLAVVFQRKRRGTGYTEQLQQYSSPGLGVKYYIDPSTYEDPCQAIR
ELAREVDPAYIKIEEVIGTGSFGEVRQGRLQPRGRREQTVAIQALWAGGAESLQMTFLGR
AAVLGQFQHPNILRLEGVVTKSRPLMVLTEFMELGPLDSFLRQREGQFSSLQLVAMQRGV
AAAMQYLSSFAFVHRSLSAHSVLVNSHLVCKVARLGHSPQGPSCLLRWAAPEVIAHGKHT
TSSDVWSFGILMWEVMSYGERPYWDMSEQEVLNAIEQEFRLPPPPGCPPGLHLLMLDTWQ
KDRARRPHFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSA
IGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSV
EV
NT seq 3069 nt NT seq  +upstreamnt  +downstreamnt
atggctactgaaggggctgcccagttagggaacagagtggcgggcatggtgtgtagccta
tgggtgctgctcctggtgtcttcagttctggctctggaagaggtattgctggacaccacc
ggagagacatctgagattggctggctcacctacccaccaggggggtgggacgaggtgagt
gttctggacgaccagcgacgcctgactcggacctttgaggcatgtcatgtggcaggggcc
cctccaggcaccgggcaggacaattggttgcagacacactttgtggagcggcgcggggcc
cagagggcgcacattcgactccacttctctgtgcgggcatgctccagcctgggtgtgagc
ggcggcacctgccgggagaccttcaccctttactaccgtcaggctgaggagcccgacagc
cctgacagcgtttcctcctggcacctcaaacgctggaccaaggtggacacaattgcagca
gacgagagctttccctcctcctcctcctcctcctcctcctcttcttcctctgcagcgtgg
gctgtgggaccccacggggctgggcagcgggctggactgcaactgaacgtcaaagagcgg
agctttgggcctctcacccaacgcggcttctacgtggccttccaggacacgggggcctgc
ctggccctggtcgctgtcaggctcttctcctacacctgccctgccgtgctccgatccttt
gcttcctttccagagacgcaggccagtggggctgggggggcctccctggtggcagctgtg
ggcacctgtgtggctcatgcagagccagaggaggatggagtagggggccaggcaggaggc
agcccccccaggctgcactgcaacggggagggcaagtggatggtagctgtcgggggctgc
cgctgccagcctggataccaaccagcacgaggagacaaggcctgccaagcctgcccacgg
gggctctataaggcttctgctgggaatgctccctgctcaccatgccctgcccgcagtcac
gctcccaacccagcagcccccgtttgcccctgcctggagggcttctaccgggccagttcc
gacccaccagaggccccctgcactggtcctccatcggctccccaggagctttggtttgag
gtgcaaggctcagcactcatgctacactggcgcctgcctcgggagctggggggtcgaggg
gacctgctcttcaatgtcgtgtgcaaggagtgtgaaggccgccaggaacctgccagcggt
ggtgggggcacttgtcaccgctgcagggatgaggtccacttcgaccctcgccagagaggc
ctgactgagagccgagtgttagtggggggactccgggcacacgtaccctacatcttagag
gtgcaggctgttaatggggtgtctgagctcagccctgaccctcctcaggctgcagccatc
aatgtcagcaccagccatgaagtgccctctgctgtccctgtggtgcaccaggtgagccgg
gcatccaacagcatcacggtgtcctggccgcagcccgaccagaccaatgggaacatcctg
gactatcagctccgctactatgaccaggcagaagacgaatcccactccttcaccctgacc
agcgagaccaacactgccaccgtgacacagctgagccctggccacatctatggtttccag
gtgcgggcccggactgctgccggccacggcccctacgggggcaaagtctatttccagaca
cttcctcaaggggagctgtcttcccagcttccagaaagactctccttggtgatcggctcc
atcctgggggctttggccttcctcctgctggcagccatcaccgtgctggcggtcgtcttc
cagcggaagcggcgtgggactggctacacagagcagctgcagcaatacagcagcccagga
ctcggggtgaagtattacatcgacccctccacctacgaggacccctgtcaggccatccga
gaacttgcccgggaagtcgatcctgcttatatcaagattgaggaggtcattgggacaggc
tcttttggagaagtgcgccagggccgcctgcagccacggggacggagggagcagactgtg
gccatccaggccctgtgggccgggggcgccgaaagcctgcagatgaccttcctgggccgg
gccgcagtgctgggtcagttccagcaccccaacatcctgcggctggagggcgtggtcacc
aagagccgacccctcatggtgctgacggagttcatggagcttggccccctggacagcttc
ctcaggcagcgggagggccagttcagcagcctgcagctggtggccatgcagcggggagtg
gctgctgccatgcagtacctgtccagctttgccttcgtccatcgctcgctgtctgcccac
agcgtgctggtgaatagccacttggtgtgcaaggtggcccgtcttggccacagtcctcag
ggcccaagttgtttgcttcgctgggcagccccagaggtcattgcacatggaaagcataca
acatccagtgatgtctggagctttgggatactcatgtgggaagtgatgagttatggagaa
cggccttactgggacatgagtgagcaggaggtactaaatgcaatagagcaggagttccgg
ctgcccccgcctccaggctgtcctcctggattacatctacttatgttggacacttggcag
aaggaccgtgcccggcggcctcattttgaccagctggtggctgcatttgacaagatgatc
cgcaagccagataccctgcaggctggcggggacccaggggaaaggccttcccaggccctt
ctgacccctgtggccctggactttccttgtctggactcaccccaggcctggctttcagcc
attggactggagtgctaccaggacaacttctccaagtttggcctctgtaccttcagtgat
gtggctcagctcagcctagaagacctgcctgccctgggcatcaccctggctggccaccag
aagaagctgctgcaccacatccagctccttcagcaacacctgaggcagcagggctcagtg
gaggtctga

DBGET integrated database retrieval system