KEGG   Homo sapiens (human): 2065Help
Entry
2065              CDS       T01001                                 

Gene name
ERBB3, ErbB-3, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3
Definition
(RefSeq) erb-b2 receptor tyrosine kinase 3
  KO
K05084  receptor tyrosine-protein kinase erbB-3 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
Disease
H00408  Type I diabetes mellitus
H00865  Lethal congenital contractural syndrome (LCCS)
Drug target
Canertinib dihydrochloride: D03350
Istiratumab: D10943
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    2065 (ERBB3)
   04012 ErbB signaling pathway
    2065 (ERBB3)
   04020 Calcium signaling pathway
    2065 (ERBB3)
   04151 PI3K-Akt signaling pathway
    2065 (ERBB3)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    2065 (ERBB3)
   05205 Proteoglycans in cancer
    2065 (ERBB3)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2065 (ERBB3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2065 (ERBB3)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   2065 (ERBB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Furin-like Pkinase Kinase-like
Motif
Other DBs
NCBI-GeneID: 2065
NCBI-ProteinID: NP_001973
OMIM: 190151
HGNC: 3431
Ensembl: ENSG00000065361
Vega: OTTHUMG00000170140
Pharos: P21860(Tchem)
UniProt: P21860
LinkDB All DBs
Structure
PDB: 

Position
12q13.2
AA seq 1342 aa AA seqDB search
MRANDALQVLGLLFSLARGSEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVM
GNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNLRVVRGTQVYDGKFAIFVM
LNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNG
RSCPPCHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQD
TDCFACRHFNDSGACVPRCPQPLVYNKLTFQLEPNPHTKYQYGGVCVASCPHNFVVDQTS
CVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGFVNCTKILGN
LDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGG
RSLYNRGFSLLIMKNLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEE
RLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQCLSCRNYSRGGVCVTHCNFLNGEP
REFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI
YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTMALTVIAGLVVIFMMLG
GTFLYWRGRRIQNKRAMRRYLERGESIEPLDPSEKANKVLARIFKETELRKLKVLGSGVF
GTVHKGVWIPEGESIKIPVCIKVIEDKSGRQSFQAVTDHMLAIGSLDHAHIVRLLGLCPG
SSLQLVTQYLPLGSLLDHVRQHRGALGPQLLLNWGVQIAKGMYYLEEHGMVHRNLAARNV
LLKSPSQVQVADFGVADLLPPDDKQLLYSEAKTPIKWMALESIHFGKYTHQSDVWSYGVT
VWELMTFGAEPYAGLRLAEVPDLLEKGERLAQPQICTIDVYMVMVKCWMIDENIRPTFKE
LANEFTRMARDPPRYLVIKRESGPGIAPGPEPHGLTNKKLEEVELEPELDLDLDLEAEED
NLATTTLGSALSLPVGTLNRPRGSQSLLSPSSGYMPMNQGNLGESCQESAVSGSSERCPR
PVSLHPMPRGCLASESSEGHVTGSEAELQEKVSMCRSRSRSRSPRPRGDSAYHSQRHSLL
TPVTPLSPPGLEEEDVNGYVMPDTHLKGTPSSREGTLSSVGLSSVLGTEEEDEDEEYEYM
NRRRRHSPPHPPRPSSLEELGYEYMDVGSDLSASLGSTQSCPLHPVPIMPTAGTTPDEDY
EYMNRQRDGGGPGGDYAAMGACPASEQGYEEMRAFQGPGHQAPHVHYARLKTLRSLEATD
SAFDNPDYWHSRLFPKANAQRT
NT seq 4029 nt NT seq  +upstreamnt  +downstreamnt
atgagggcgaacgacgctctgcaggtgctgggcttgcttttcagcctggcccggggctcc
gaggtgggcaactctcaggcagtgtgtcctgggactctgaatggcctgagtgtgaccggc
gatgctgagaaccaataccagacactgtacaagctctacgagaggtgtgaggtggtgatg
gggaaccttgagattgtgctcacgggacacaatgccgacctctccttcctgcagtggatt
cgagaagtgacaggctatgtcctcgtggccatgaatgaattctctactctaccattgccc
aacctccgcgtggtgcgagggacccaggtctacgatgggaagtttgccatcttcgtcatg
ttgaactataacaccaactccagccacgctctgcgccagctccgcttgactcagctcacc
gagattctgtcagggggtgtttatattgagaagaacgataagctttgtcacatggacaca
attgactggagggacatcgtgagggaccgagatgctgagatagtggtgaaggacaatggc
agaagctgtcccccctgtcatgaggtttgcaaggggcgatgctggggtcctggatcagaa
gactgccagacattgaccaagaccatctgtgctcctcagtgtaatggtcactgctttggg
cccaaccccaaccagtgctgccatgatgagtgtgccgggggctgctcaggccctcaggac
acagactgctttgcctgccggcacttcaatgacagtggagcctgtgtacctcgctgtcca
cagcctcttgtctacaacaagctaactttccagctggaacccaatccccacaccaagtat
cagtatggaggagtttgtgtagccagctgtccccataactttgtggtggatcaaacatcc
tgtgtcagggcctgtcctcctgacaagatggaagtagataaaaatgggctcaagatgtgt
gagccttgtgggggactatgtcccaaagcctgtgagggaacaggctctgggagccgcttc
cagactgtggactcgagcaacattgatggatttgtgaactgcaccaagatcctgggcaac
ctggactttctgatcaccggcctcaatggagacccctggcacaagatccctgccctggac
ccagagaagctcaatgtcttccggacagtacgggagatcacaggttacctgaacatccag
tcctggccgccccacatgcacaacttcagtgttttttccaatttgacaaccattggaggc
agaagcctctacaaccggggcttctcattgttgatcatgaagaacttgaatgtcacatct
ctgggcttccgatccctgaaggaaattagtgctgggcgtatctatataagtgccaatagg
cagctctgctaccaccactctttgaactggaccaaggtgcttcgggggcctacggaagag
cgactagacatcaagcataatcggccgcgcagagactgcgtggcagagggcaaagtgtgt
gacccactgtgctcctctgggggatgctggggcccaggccctggtcagtgcttgtcctgt
cgaaattatagccgaggaggtgtctgtgtgacccactgcaactttctgaatggggagcct
cgagaatttgcccatgaggccgaatgcttctcctgccacccggaatgccaacccatggag
ggcactgccacatgcaatggctcgggctctgatacttgtgctcaatgtgcccattttcga
gatgggccccactgtgtgagcagctgcccccatggagtcctaggtgccaagggcccaatc
tacaagtacccagatgttcagaatgaatgtcggccctgccatgagaactgcacccagggg
tgtaaaggaccagagcttcaagactgtttaggacaaacactggtgctgatcggcaaaacc
catctgacaatggctttgacagtgatagcaggattggtagtgattttcatgatgctgggc
ggcacttttctctactggcgtgggcgccggattcagaataaaagggctatgaggcgatac
ttggaacggggtgagagcatagagcctctggaccccagtgagaaggctaacaaagtcttg
gccagaatcttcaaagagacagagctaaggaagcttaaagtgcttggctcgggtgtcttt
ggaactgtgcacaaaggagtgtggatccctgagggtgaatcaatcaagattccagtctgc
attaaagtcattgaggacaagagtggacggcagagttttcaagctgtgacagatcatatg
ctggccattggcagcctggaccatgcccacattgtaaggctgctgggactatgcccaggg
tcatctctgcagcttgtcactcaatatttgcctctgggttctctgctggatcatgtgaga
caacaccggggggcactggggccacagctgctgctcaactggggagtacaaattgccaag
ggaatgtactaccttgaggaacatggtatggtgcatagaaacctggctgcccgaaacgtg
ctactcaagtcacccagtcaggttcaggtggcagattttggtgtggctgacctgctgcct
cctgatgataagcagctgctatacagtgaggccaagactccaattaagtggatggccctt
gagagtatccactttgggaaatacacacaccagagtgatgtctggagctatggtgtgaca
gtttgggagttgatgaccttcggggcagagccctatgcagggctacgattggctgaagta
ccagacctgctagagaagggggagcggttggcacagccccagatctgcacaattgatgtc
tacatggtgatggtcaagtgttggatgattgatgagaacattcgcccaacctttaaagaa
ctagccaatgagttcaccaggatggcccgagacccaccacggtatctggtcataaagaga
gagagtgggcctggaatagcccctgggccagagccccatggtctgacaaacaagaagcta
gaggaagtagagctggagccagaactagacctagacctagacttggaagcagaggaggac
aacctggcaaccaccacactgggctccgccctcagcctaccagttggaacacttaatcgg
ccacgtgggagccagagccttttaagtccatcatctggatacatgcccatgaaccagggt
aatcttggggagtcttgccaggagtctgcagtttctgggagcagtgaacggtgcccccgt
ccagtctctctacacccaatgccacggggatgcctggcatcagagtcatcagaggggcat
gtaacaggctctgaggctgagctccaggagaaagtgtcaatgtgtaggagccggagcagg
agccggagcccacggccacgcggagatagcgcctaccattcccagcgccacagtctgctg
actcctgttaccccactctccccacccgggttagaggaagaggatgtcaacggttatgtc
atgccagatacacacctcaaaggtactccctcctcccgggaaggcaccctttcttcagtg
ggtctcagttctgtcctgggtactgaagaagaagatgaagatgaggagtatgaatacatg
aaccggaggagaaggcacagtccacctcatccccctaggccaagttcccttgaggagctg
ggttatgagtacatggatgtggggtcagacctcagtgcctctctgggcagcacacagagt
tgcccactccaccctgtacccatcatgcccactgcaggcacaactccagatgaagactat
gaatatatgaatcggcaacgagatggaggtggtcctgggggtgattatgcagccatgggg
gcctgcccagcatctgagcaagggtatgaagagatgagagcttttcaggggcctggacat
caggccccccatgtccattatgcccgcctaaaaactctacgtagcttagaggctacagac
tctgcctttgataaccctgattactggcatagcaggcttttccccaaggctaatgcccag
agaacgtaa

DBGET integrated database retrieval system