KEGG   Homo sapiens (human): 2078Help
Entry
2078              CDS       T01001                                 

Gene name
ERG, erg-3, p55
Definition
(RefSeq) ETS transcription factor ERG
  KO
K09435  transcriptional regulator ERG
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
nt06272  Prostate cancer
  Element
N00128  TMPRSS2-ERG fusion to transcriptional activation
N00129  TMPRSS2-ERG fusion to transcriptional repression
N00135  EWSR1-ERG fusion to transcriptional activation
Disease
H00024  Prostate cancer
H00035  Ewing sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2078 (ERG)
  09162 Cancer: specific types
   05215 Prostate cancer
    2078 (ERG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2078 (ERG)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2078 (ERG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3 SAM_2 SAM_1 Arb2
Motif
Other DBs
NCBI-GeneID: 2078
NCBI-ProteinID: NP_001129626
OMIM: 165080
HGNC: 3446
Ensembl: ENSG00000157554
Vega: OTTHUMG00000090767
Pharos: P11308(Tchem)
UniProt: P11308 B4DN83
LinkDB All DBs
Structure
PDB: 

Position
21q22.2
AA seq 486 aa AA seqDB search
MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQTSKMSPRVPQ
QDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKMVGSPDTVGMNYGSYMEEKHM
PPPNMTTNERRVIVPADPTLWSTDHVRQWLEWAVKEYGLPDVNILLFQNIDGKELCKMTK
DDFQRLTPSYNADILLSHLHYLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPN
TSVYPEATQRITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGE
RKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPHPPESSLYKYPS
DLPYMGSYHAHPQKMNFVAPHPPALPVTSSSFFAAPNPYWNSPTGGIYPNTRLPTSHMPS
HLGTYY
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgattcagactgtcccggacccagcagctcatatcaaggaagccttatcagttgtgagt
gaggaccagtcgttgtttgagtgtgcctacggaacgccacacctggctaagacagagatg
accgcgtcctcctccagcgactatggacagacttccaagatgagcccacgcgtccctcag
caggattggctgtctcaacccccagccagggtcaccatcaaaatggaatgtaaccctagc
caggtgaatggctcaaggaactctcctgatgaatgcagtgtggccaaaggcgggaagatg
gtgggcagcccagacaccgttgggatgaactacggcagctacatggaggagaagcacatg
ccacccccaaacatgaccacgaacgagcgcagagttatcgtgccagcagatcctacgcta
tggagtacagaccatgtgcggcagtggctggagtgggcggtgaaagaatatggccttcca
gacgtcaacatcttgttattccagaacatcgatgggaaggaactgtgcaagatgaccaag
gacgacttccagaggctcacccccagctacaacgccgacatccttctctcacatctccac
tacctcagagagactcctcttccacatttgacttcagatgatgttgataaagccttacaa
aactctccacggttaatgcatgctagaaacacagggggtgcagcttttattttcccaaat
acttcagtatatcctgaagctacgcaaagaattacaactaggccagatttaccatatgag
ccccccaggagatcagcctggaccggtcacggccaccccacgccccagtcgaaagctgct
caaccatctccttccacagtgcccaaaactgaagaccagcgtcctcagttagatccttat
cagattcttggaccaacaagtagccgccttgcaaatccaggcagtggccagatccagctt
tggcagttcctcctggagctcctgtcggacagctccaactccagctgcatcacctgggaa
ggcaccaacggggagttcaagatgacggatcccgacgaggtggcccggcgctggggagag
cggaagagcaaacccaacatgaactacgataagctcagccgcgccctccgttactactat
gacaagaacatcatgaccaaggtccatgggaagcgctacgcctacaagttcgacttccac
gggatcgcccaggccctccagccccaccccccggagtcatctctgtacaagtacccctca
gacctcccgtacatgggctcctatcacgcccacccacagaagatgaactttgtggcgccc
caccctccagccctccccgtgacatcttccagtttttttgctgccccaaacccatactgg
aattcaccaactgggggtatataccccaacactaggctccccaccagccatatgccttct
catctgggcacttactactaa

DBGET integrated database retrieval system