KEGG   Homo sapiens (human): 2099
Entry
2099              CDS       T01001                                 
Symbol
ESR1, ER, ESR, ESRA, ESTRR, Era, NR3A1
Name
(RefSeq) estrogen receptor 1
  KO
K08550  estrogen receptor alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05207  Chemical carcinogenesis - receptor activation
hsa05224  Breast cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06227  Nuclear receptor signaling
nt06270  Breast cancer
nt06323  KISS1-GnRH-LH/FSH-E2 signaling
  Element
N00286  Nuclear-initiated estrogen signaling pathway
N00287  ESR1-positive to nuclear-initiated estrogen signaling pathway
N00887  Mutation-inactivated ESR1 to nuclear-initiated estrogen signaling pathway
N01350  NNK/NNN to PI3K signaling pathway
N01351  E2-ER-RAS-ERK signaling pathway
N01352  BPA to RAS-ERK signaling pathway
N01353  E2 to RAS-ERK signaling pathway
N01364  E2 to nuclear-initiated estrogen signaling pathway
Disease
H00031  Breast cancer
H01730  Myocardial infarction
H02061  Estrogen resistance syndrome
Drug target
Acolbifene hydrochloride: D02758
Afimoxifene: D06551
Alfatradiol: D07121
Amcenestrant: D12145
Arzoxifene hydrochloride: D02993
Bazedoxifene: D03062<JP>
Brilanestrant: D11264
Camizestrant: D12049
Chlorotrianisene: D00269
Clometherone: D03551
Clomifene (DG00474): D00962<JP/US> D07726
Danazol: D00289<JP/US>
Delmadinone (DG02935): D07783
Desogestrel: D02367
Dienestrol: D00898
Diethylstilbestrol (DG00466): D00577 D00946 D07826
Droloxifene (DG01265): D03911 D03912
Elacestrant (DG03078): D11671 D11672
Enclomiphene (DG01992): D08910 D10876
Epitiostanol: D01265
Equilin: D04041
Estetrol (DG03027): D11513 D11514
Estradiol (DG00462): D00105<JP/US> D01413<JP/US> D01617 D01953 D04061<US> D04063<US> D04064 D04065 D07918<US> D07919
Estriol (DG00463): D00185<JP> D01986 D01989 D07920 D07921
Estrogens, esterified: D04071<US>
Estrone (DG00464): D00067 D00312 D00948
Ethinylestradiol (DG00461): D00554<JP> D07928
Etonogestrel: D04104<US>
Etynodiol (DG00470): D01294 D07939
Fispemifene: D10008
Fluoroestradiol (18F): D11829<US>
Fulvestrant: D01161<JP/US>
Hexestrol (DG02847): D01641 D02018
Idoxifene: D04496
Lasofoxifene: D04672
Levormeloxifene fumarate: D09834
Mepitiostane: D01602<JP>
Mestranol: D00575
Miproxifene phosphate: D01853
Nafoxidine hydrochloride: D05106
Nitromifene citrate: D05192
Ormeloxifen: D08301
Ospemifene: D08958<US>
Polyestradiol phosphate: D07434
Prasterone (DG00141): D01616 D08409<US>
Promestriene: D07221
Quinestrol: D00576
Raloxifene (DG00476): D02217<JP/US> D08465 D10606<JP>
Tamoxifen (DG00734): D00966<JP/US> D08559
Tibolone: D01639
Toremifene (DG00735): D00967<JP/US> D08620
Trioxifene mesylate: D06245
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    2099 (ESR1)
   04917 Prolactin signaling pathway
    2099 (ESR1)
   04919 Thyroid hormone signaling pathway
    2099 (ESR1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    2099 (ESR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2099 (ESR1)
   05205 Proteoglycans in cancer
    2099 (ESR1)
   05207 Chemical carcinogenesis - receptor activation
    2099 (ESR1)
  09162 Cancer: specific types
   05224 Breast cancer
    2099 (ESR1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    2099 (ESR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2099 (ESR1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    2099 (ESR1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    2099 (ESR1)
Nuclear receptors [BR:hsa03310]
 3. Estrogen like
  3A. Estrogen receptor
   2099 (ESR1)
SSDB
Motif
Pfam: Oest_recep Hormone_recep zf-C4 ESR1_C
Other DBs
NCBI-GeneID: 2099
NCBI-ProteinID: NP_000116
OMIM: 133430
HGNC: 3467
Ensembl: ENSG00000091831
Pharos: P03372(Tclin)
UniProt: P03372 G4XH65
Structure
LinkDB
Position
6:151656672..152129619
AA seq 595 aa
MTMTLHTKASGMALLHQIQGNELEPLNRPQLKIPLERPLGEVYLDSSKPAVYNYPEGAAY
EFNAAAAANAQVYGQTGLPYGPGSEAAAFGSNGLGGFPPLNSVSPSPLMLLHPPPQLSPF
LQPHGQQVPYYLENEPSGYTVREAGPPAFYRPNSDNRRQGGRERLASTNDKGSMAMESAK
ETRYCAVCNDYASGYHYGVWSCEGCKAFFKRSIQGHNDYMCPATNQCTIDKNRRKSCQAC
RLRKCYEVGMMKGGIRKDRRGGRMLKHKRQRDDGEGRGEVGSAGDMRAANLWPSPLMIKR
SKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMMGLLTNLADRELVHMINW
AKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPGKLLFAPNLLLDRNQGKCVEG
MVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTFLSSTLKSLEEKDHIHRVLD
KITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNKGMEHLYSMKCKNVVPLYDLL
LEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSLQKYYITGEAEGFPATV
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgaccatgaccctccacaccaaagcatctgggatggccctactgcatcagatccaaggg
aacgagctggagcccctgaaccgtccgcagctcaagatccccctggagcggcccctgggc
gaggtgtacctggacagcagcaagcccgccgtgtacaactaccccgagggcgccgcctac
gagttcaacgccgcggccgccgccaacgcgcaggtctacggtcagaccggcctcccctac
ggccccgggtctgaggctgcggcgttcggctccaacggcctggggggtttccccccactc
aacagcgtgtctccgagcccgctgatgctactgcacccgccgccgcagctgtcgcctttc
ctgcagccccacggccagcaggtgccctactacctggagaacgagcccagcggctacacg
gtgcgcgaggccggcccgccggcattctacaggccaaattcagataatcgacgccagggt
ggcagagaaagattggccagtaccaatgacaagggaagtatggctatggaatctgccaag
gagactcgctactgtgcagtgtgcaatgactatgcttcaggctaccattatggagtctgg
tcctgtgagggctgcaaggccttcttcaagagaagtattcaaggacataacgactatatg
tgtccagccaccaaccagtgcaccattgataaaaacaggaggaagagctgccaggcctgc
cggctccgtaaatgctacgaagtgggaatgatgaaaggtgggatacgaaaagaccgaaga
ggagggagaatgttgaaacacaagcgccagagagatgatggggagggcaggggtgaagtg
gggtctgctggagacatgagagctgccaacctttggccaagcccgctcatgatcaaacgc
tctaagaagaacagcctggccttgtccctgacggccgaccagatggtcagtgccttgttg
gatgctgagcccccgatactctattccgagtatgatcctaccagacccttcagtgaagct
tcgatgatgggcttactgaccaacctggcagacagggagctggttcacatgatcaactgg
gcgaagagggtgccaggctttgtggatttgaccctccatgatcaggtccaccttctagaa
tgtgcctggctagagatcctgatgattggtctcgtctggcgctccatggagcacccaggg
aagctactgtttgctcctaacttgctcttggacaggaaccagggaaaatgtgtagagggc
atggtggagatcttcgacatgctgctggctacatcatctcggttccgcatgatgaatctg
cagggagaggagtttgtgtgcctcaaatctattattttgcttaattctggagtgtacaca
tttctgtccagcaccctgaagtctctggaagagaaggaccatatccaccgagtcctggac
aagatcacagacactttgatccacctgatggccaaggcaggcctgaccctgcagcagcag
caccagcggctggcccagctcctcctcatcctctcccacatcaggcacatgagtaacaaa
ggcatggagcatctgtacagcatgaagtgcaagaacgtggtgcccctctatgacctgctg
ctggagatgctggacgcccaccgcctacatgcgcccactagccgtggaggggcatccgtg
gaggagacggaccaaagccacttggccactgcgggctctacttcatcgcattccttgcaa
aagtattacatcacgggggaggcagagggtttccctgccacggtctga

DBGET integrated database retrieval system