KEGG   Homo sapiens (human): 2113Help
Entry
2113              CDS       T01001                                 

Gene name
ETS1, ETS-1, EWSR2, c-ets-1, p54
Definition
(RefSeq) ETS proto-oncogene 1, transcription factor
  KO
K02678  C-ets-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04218  Cellular senescence
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2113 (ETS1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    2113 (ETS1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2113 (ETS1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    2113 (ETS1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2113 (ETS1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2113 (ETS1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2113 (ETS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT HSF_DNA-bind
Motif
Other DBs
NCBI-GeneID: 2113
NCBI-ProteinID: NP_005229
OMIM: 164720
HGNC: 3488
Ensembl: ENSG00000134954
Vega: OTTHUMG00000165799
Pharos: P14921(Tbio)
UniProt: P14921 B4DW78
LinkDB All DBs
Structure
PDB: 

Position
11q24.3
AA seq 441 aa AA seqDB search
MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQ
QRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDF
VGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF
ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGR
TSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKP
KGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDG
WEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQS
LLGYTPEELHAMLDVKPDADE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcggccgtcgatctcaagccgactctcaccatcatcaagacggaaaaagtcgat
ctggagcttttcccctccccggatatggaatgtgcagatgtcccactattaactccaagc
agcaaagaaatgatgtctcaagcattaaaagctactttcagtggtttcactaaagaacag
caacgactggggatcccaaaagacccccggcagtggacagaaacccatgttcgggactgg
gtgatgtgggctgtgaatgaattcagcctgaaaggtgtagacttccagaagttctgtatg
aatggagcagccctctgcgccctgggtaaagactgctttctcgagctggccccagacttt
gttggggacatcttatgggaacatctagagatcctgcagaaagaggatgtgaaaccatat
caagttaatggagtcaacccagcctatccagaatcccgctatacctcggattacttcatt
agctatggtattgagcatgcccagtgtgttccaccatcggagttctcagagcccagcttc
atcacagagtcctatcagacgctccatcccatcagctcggaagagctcctctccctcaag
tatgagaatgactacccctcggtcattctccgagaccctctccagacagacaccttgcag
aatgactactttgctatcaaacaagaagtcgtcaccccagacaacatgtgcatggggagg
accagtcgtggtaaactcgggggccaggactcttttgaaagcatagagagctacgatagt
tgtgatcgcctcacccagtcctggagcagccagtcatctttcaacagcctgcagcgtgtt
ccctcctatgacagcttcgactcagaggactatccggctgccctgcccaaccacaagccc
aagggcaccttcaaggactatgtgcgggaccgtgctgacctcaataaggacaagcctgtc
attcctgctgctgccctagctggctacacaggcagtggaccaatccagctatggcagttt
cttctggaattactcactgataaatcctgtcagtcttttatcagctggacaggagatggc
tgggaattcaaactttctgacccagatgaggtggccaggagatggggaaagaggaaaaac
aaacctaagatgaattatgagaaactgagccgtggcctacgctactattacgacaaaaac
atcatccacaagacagcggggaaacgctacgtgtaccgctttgtgtgtgacctgcagagc
ctgctggggtacacccctgaggagctgcacgccatgctggacgtcaagccagatgccgac
gagtga

KEGG   Homo sapiens (human): 2114Help
Entry
2114              CDS       T01001                                 

Gene name
ETS2, ETS2IT1
Definition
(RefSeq) ETS proto-oncogene 2, transcription factor
  KO
K21932  C-ets-2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2114 (ETS2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    2114 (ETS2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2114 (ETS2)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2114 (ETS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT
Motif
Other DBs
NCBI-GeneID: 2114
NCBI-ProteinID: NP_005230
OMIM: 164740
HGNC: 3489
Ensembl: ENSG00000157557
Vega: OTTHUMG00000090769
Pharos: P15036(Tbio)
UniProt: P15036
LinkDB All DBs
Structure
PDB: 

Position
21q22.2
AA seq 469 aa AA seqDB search
MNDFGIKNMDQVAPVANSYRGTLKRQPAFDTFDGSLFAVFPSLNEEQTLQEVPTGLDSIS
HDSANCELPLLTPCSKAVMSQALKATFSGFKKEQRRLGIPKNPWLWSEQQVCQWLLWATN
EFSLVNVNLQRFGMNGQMLCNLGKERFLELAPDFVGDILWEHLEQMIKENQEKTEDQYEE
NSHLTSVPHWINSNTLGFGTEQAPYGMQTQNYPKGGLLDSMCPASTPSVLSSEQEFQMFP
KSRLSSVSVTYCSVSQDFPGSNLNLLTNNSGTPKDHDSPENGADSFESSDSLLQSWNSQS
SLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGS
GPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVARRWGKRKNKPKMNYEKLSRG
LRYYYDKNIIHKTSGKRYVYRFVCDLQNLLGFTPEELHAILGVQPDTED
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatttcggaatcaagaatatggaccaggtagcccctgtggctaacagttacaga
gggacactcaagcgccagccagcctttgacacctttgatgggtccctgtttgctgttttt
ccttctctaaatgaagagcaaacactgcaagaagtgccaacaggcttggattccatttct
catgactccgccaactgtgaattgcctttgttaaccccgtgcagcaaggctgtgatgagt
caagccttaaaagctaccttcagtggcttcaaaaaggaacagcggcgcctgggcattcca
aagaacccctggctgtggagtgagcaacaggtatgccagtggcttctctgggccaccaat
gagttcagtctggtgaacgtgaatctgcagaggttcggcatgaatggccagatgctgtgt
aaccttggcaaggaacgctttctggagctggcacctgactttgtgggtgacattctctgg
gaacatctggagcaaatgatcaaagaaaaccaagaaaagacagaagatcaatatgaagaa
aattcacacctcacctccgttcctcattggattaacagcaatacattaggttttggcaca
gagcaggcgccctatggaatgcagacacagaattaccccaaaggcggcctcctggacagc
atgtgtccggcctccacacccagcgtactcagctctgagcaggagtttcagatgttcccc
aagtctcggctcagctccgtcagcgtcacctactgctctgtcagtcaggacttcccaggc
agcaacttgaatttgctcaccaacaattctgggactcccaaagaccacgactcccctgag
aacggtgcggacagcttcgagagctcagactccctcctccagtcctggaacagccagtcg
tccttgctggatgtgcaacgggttccttccttcgagagcttcgaagatgactgcagccag
tctctctgcctcaataagccaaccatgtctttcaaggattacatccaagagaggagtgac
ccagtggagcaaggcaaaccagttatacctgcagctgtgctggccggcttcacaggaagt
ggacctattcagctgtggcagtttctcctggagctgctatcagacaaatcctgccagtca
ttcatcagctggactggagacggatgggagtttaagctcgccgaccccgatgaggtggcc
cgccggtggggaaagaggaaaaataagcccaagatgaactacgagaagctgagccggggc
ttacgctactattacgacaagaacatcatccacaagacgtcggggaagcgctacgtgtac
cgcttcgtgtgcgacctccagaacttgctggggttcacgcccgaggaactgcacgccatc
ctgggcgtccagcccgacacggaggactga

DBGET integrated database retrieval system