KEGG   Homo sapiens (human): 2115Help
Entry
2115              CDS       T01001                                 

Gene name
ETV1, ER81
Definition
(RefSeq) ETS variant transcription factor 1
  KO
K09431  ets translocation variant 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00024  Prostate cancer
H00035  Ewing sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2115 (ETV1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2115 (ETV1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2115 (ETV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETS_PEA3_N Ets
Motif
Other DBs
NCBI-GeneID: 2115
NCBI-ProteinID: NP_004947
OMIM: 600541
HGNC: 3490
Ensembl: ENSG00000006468
Vega: OTTHUMG00000152403
Pharos: P50549(Tbio)
UniProt: P50549
LinkDB All DBs
Structure
PDB: 

Position
7p21.2
AA seq 477 aa AA seqDB search
MDGFYDQQVPYMVTNSQRGRNCNEKPTNVRKRKFINRDLAHDSEELFQDLSQLQETWLAE
AQVPDNDEQFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCLYN
VSAYDQKPQVGMRPSNPPTPSSTPVSPLHHASPNSTHTPKPDRAFPAHLPPSQSIPDSSY
PMDHRFRRQLSEPCNSFPPLPTMPREGRPMYQRQMSEPNIPFPPQGFKQEYHDPVYEHNT
MVGSAASQSFPPPLMIKQEPRDFAYDSEVPSCHSIYMRQEGFLAHPSRTEGCMFEKGPRQ
FYDDTCVVPEKFDGDIKQEPGMYREGPTYQRRGSLQLWQFLVALLDDPSNSHFIAWTGRG
MEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKFVCDPEA
LFSMAFPDNQRPLLKTDMERHINEEDTVPLSHFDESMAYMPEGGCCNPHPYNEGYVY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggatggattttatgaccagcaagtgccttacatggtcaccaatagtcagcgtgggaga
aattgtaacgagaaaccaacaaatgtcaggaaaagaaaattcattaacagagatctggct
catgattcagaagaactctttcaagatctaagtcaattacaggaaacatggcttgcagaa
gctcaggtacctgacaatgatgagcagtttgtaccagactatcaggctgaaagtttggct
tttcatggcctgccactgaaaatcaagaaagaaccccacagtccatgttcagaaatcagc
tctgcctgcagtcaagaacagccctttaaattcagctatggagaaaagtgcctgtacaat
gtcagtgcctatgatcagaagccacaagtgggaatgaggccctccaacccccccacacca
tccagcacgccagtgtccccactgcatcatgcatctccaaactcaactcatacaccgaaa
cctgaccgggccttcccagctcacctccctccatcgcagtccataccagatagcagctac
cccatggaccacagatttcgccgccagctttctgaaccctgtaactcctttcctcctttg
ccgacgatgccaagggaaggacgtcctatgtaccaacgccagatgtctgagccaaacatc
cccttcccaccacaaggctttaagcaggagtaccacgacccagtgtatgaacacaacacc
atggttggcagtgcggccagccaaagctttccccctcctctgatgattaaacaggaaccc
agagattttgcatatgactcagaagtgcctagctgccactccatttatatgaggcaagaa
ggcttcctggctcatcccagcagaacagaaggctgtatgtttgaaaagggccccaggcag
ttttatgatgacacctgtgttgtcccagaaaaattcgatggagacatcaaacaagagcca
ggaatgtatcgggaaggacccacataccaacggcgaggatcacttcagctctggcagttt
ttggtagctcttctggatgacccttcaaattctcattttattgcctggactggtcgaggc
atggaatttaaactgattgagcctgaagaggtggcccgacgttggggcattcagaaaaac
aggccagctatgaactatgataaacttagccgttcactccgctattactatgagaaagga
attatgcaaaaggtggctggagagagatatgtctacaagtttgtgtgtgatccagaagcc
cttttctccatggcctttccagataatcagcgtccactgctgaagacagacatggaacgt
cacatcaacgaggaggacacagtgcctctttctcactttgatgagagcatggcctacatg
ccggaagggggctgctgcaacccccacccctacaacgaaggctacgtgtattaa

DBGET integrated database retrieval system