KEGG   Homo sapiens (human): 2118Help
Entry
2118              CDS       T01001                                 

Gene name
ETV4, E1A-F, E1AF, PEA3, PEAS3
Definition
(RefSeq) ETS variant 4
  KO
K15592  ets translocation variant 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Disease
H00024  Prostate cancer
H00035  Ewing sarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2118 (ETV4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2118 (ETV4)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2118 (ETV4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETS_PEA3_N Ets
Motif
Other DBs
NCBI-GeneID: 2118
NCBI-ProteinID: NP_001073143
OMIM: 600711
HGNC: 3493
Ensembl: ENSG00000175832
Vega: OTTHUMG00000180884
Pharos: P43268(Tbio)
UniProt: P43268
LinkDB All DBs
Structure
PDB: 

Position
17q21.31
AA seq 484 aa AA seqDB search
MERRMKAGYLDQQVPYTFSSKSPGNGSLREALIGPLGKLMDPGSLPPLDSEDLFQDLSHF
QETWLAEAQVPDSDEQFVPDFHSENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYHH
GEQCLYSSAYDPPRQIAIKSPAPGALGQSPLQPFPRAEQRNFLRSSGTSQPHPGHGYLGE
HSSVFQQPLDICHSFTSQGGGREPLPAPYQHQLSEPCPPYPQQSFKQEYHDPLYEQAGQP
AVDQGGVNGHRYPGAGVVIKQEQTDFAYDSDVTGCASMYLHTEGFSGPSPGDGAMGYGYE
KPLRPFPDDVCVVPEKFEGDIKQEGVGAFREGPPYQRRGALQLWQFLVALLDDPTNAHFI
AWTGRGMEFKLIEPEEVARLWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKVAGERYVYKF
VCEPEALFSLAFPDNQRPALKAEFDRPVSEEDTVPLSHLDESPAYLPELAGPAQPFGPKG
GYSY
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atggagcggaggatgaaagccggatacttggaccagcaagtgccctacaccttcagcagc
aaatcgcccggaaatgggagcttgcgcgaagcgctgatcggcccgctggggaagctcatg
gacccgggctccctgccgcccctcgactctgaagatctcttccaggatctaagtcacttc
caggagacgtggctcgctgaagctcaggtaccagacagtgatgagcagtttgttcctgat
ttccattcagaaaacctagctttccacagccccaccaccaggatcaagaaggagccccag
agtccccgcacagacccggccctgtcctgcagcaggaagccgccactcccctaccaccat
ggcgagcagtgcctttactccagtgcctatgacccccccagacaaatcgccatcaagtcc
cctgcccctggtgcccttggacagtcgcccctacagccctttccccgggcagagcaacgg
aatttcctgagatcctctggcacctcccagccccaccctggccatgggtacctcggggaa
catagctccgtcttccagcagcccctggacatttgccactccttcacatctcagggaggg
ggccgggaacccctcccagccccctaccaacaccagctgtcggagccctgcccaccctat
ccccagcagagctttaagcaagaataccatgatcccctgtatgaacaggcgggccagcca
gccgtggaccagggtggggtcaatgggcacaggtacccaggggcgggggtggtgatcaaa
caggaacagacggacttcgcctacgactcagatgtcaccgggtgcgcatcaatgtacctc
cacacagagggcttctctgggccctctccaggtgacggggccatgggctatggctatgag
aaacctctgcgaccattcccagatgatgtctgcgttgtccctgagaaatttgaaggagac
atcaagcaggaaggggtcggtgcatttcgagaggggccgccctaccagcgccggggtgcc
ctgcagctgtggcaatttctggtggccttgctggatgacccaacaaatgcccatttcatt
gcctggacgggccggggaatggagttcaagctcattgagcctgaggaggtcgccaggctc
tggggcatccagaagaaccggccagccatgaattacgacaagctgagccgctcgctccga
tactattatgagaaaggcatcatgcagaaggtggctggtgagcgttacgtgtacaagttt
gtgtgtgagcccgaggccctcttctctttggccttcccggacaatcagcgtccagctctc
aaggctgagtttgaccggcctgtcagtgaggaggacacagtccctttgtcccacttggat
gagagccccgcctacctcccagagctggctggccccgcccagccatttggccccaagggt
ggctactcttactag

DBGET integrated database retrieval system