KEGG   Homo sapiens (human): 2149Help
Entry
2149              CDS       T01001                                 

Gene name
F2R, CF2R, HTR, PAR-1, PAR1, TR
Definition
(RefSeq) coagulation factor II thrombin receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Drug target
Atopaxar (DG01348): D09866 D09867
Vorapaxar (DG01349): D09765 D09766
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2149 (F2R)
   04020 Calcium signaling pathway
    2149 (F2R)
   04072 Phospholipase D signaling pathway
    2149 (F2R)
   04024 cAMP signaling pathway
    2149 (F2R)
   04151 PI3K-Akt signaling pathway
    2149 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2149 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2149 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2149 (F2R)
   04611 Platelet activation
    2149 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2149 (F2R)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2149 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2149 (F2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2149 (F2R)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 DUF4064
Motif
Other DBs
NCBI-GeneID: 2149
NCBI-ProteinID: NP_001983
OMIM: 187930
HGNC: 3537
Ensembl: ENSG00000181104
Vega: OTTHUMG00000131299
Pharos: P25116(Tclin)
UniProt: P25116 A0A024RAP7
LinkDB All DBs
Structure
PDB: 

Position
5q13.3
AA seq 425 aa AA seqDB search
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccatcaataaaagcagtcctctt
caaaaacaacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacactctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

DBGET integrated database retrieval system