KEGG   Homo sapiens (human): 2149
Entry
2149              CDS       T01001                                 

Gene name
F2R, CF2R, HTR, PAR-1, PAR1, TR
Definition
(RefSeq) coagulation factor II thrombin receptor
  KO
K03914  coagulation factor II (thrombin) receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04151  PI3K-Akt signaling pathway
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05200  Pathways in cancer
Drug target
Atopaxar (DG01348): D09866 D09867
Vorapaxar (DG01349): D09765 D09766<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2149 (F2R)
   04020 Calcium signaling pathway
    2149 (F2R)
   04072 Phospholipase D signaling pathway
    2149 (F2R)
   04024 cAMP signaling pathway
    2149 (F2R)
   04151 PI3K-Akt signaling pathway
    2149 (F2R)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2149 (F2R)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2149 (F2R)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2149 (F2R)
   04611 Platelet activation
    2149 (F2R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2149 (F2R)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2149 (F2R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2149 (F2R)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2149 (F2R)
SSDB
Motif
Pfam: 7tm_1 DUF4064
Other DBs
NCBI-GeneID: 2149
NCBI-ProteinID: NP_001983
OMIM: 187930
HGNC: 3537
Ensembl: ENSG00000181104
Vega: OTTHUMG00000131299
Pharos: P25116(Tclin)
UniProt: P25116 A0A024RAP7
LinkDB
Structure
PDB: 

Position
5q13.3
AA seq 425 aa
MGPRRLLLVAACFSLCGPLLSARTRARRPESKATNATLDPRSFLLRNPNDKYEPFWEDEE
KNESGLTEYRLVSINKSSPLQKQLPAFISEDASGYLTSSWLTLFVPSVYTGVFVVSLPLN
IMAIVVFILKMKVKKPAVVYMLHLATADVLFVSVLPFKISYYFSGSDWQFGSELCRFVTA
AFYCNMYASILLMTVISIDRFLAVVYPMQSLSWRTLGRASFTCLAIWALAIAGVVPLLLK
EQTIQVPGLNITTCHDVLNETLLEGYYAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSS
AVANRSKKSRALFLSAAVFCIFIICFGPTNVLLIAHYSFLSHTSTTEAAYFAYLLCVCVS
SISCCIDPLIYYYASSECQRYVYSILCCKESSDPSSYNSSGQLMASKMDTCSSNLNNSIY
KKLLT
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggggccgcggcggctgctgctggtggccgcctgcttcagtctgtgcggcccgctgttg
tctgcccgcacccgggcccgcaggccagaatcaaaagcaacaaatgccaccttagatccc
cggtcatttcttctcaggaaccccaatgataaatatgaaccattttgggaggatgaggag
aaaaatgaaagtgggttaactgaatacagattagtctccatcaataaaagcagtcctctt
caaaaacaacttcctgcattcatctcagaagatgcctccggatatttgaccagctcctgg
ctgacactctttgtcccatctgtgtacaccggagtgtttgtagtcagcctcccactaaac
atcatggccatcgttgtgttcatcctgaaaatgaaggtcaagaagccggcggtggtgtac
atgctgcacctggccacggcagatgtgctgtttgtgtctgtgctcccctttaagatcagc
tattacttttccggcagtgattggcagtttgggtctgaattgtgtcgcttcgtcactgca
gcattttactgtaacatgtacgcctctatcttgctcatgacagtcataagcattgaccgg
tttctggctgtggtgtatcccatgcagtccctctcctggcgtactctgggaagggcttcc
ttcacttgtctggccatctgggctttggccatcgcaggggtagtgcctctgctcctcaag
gagcaaaccatccaggtgcccgggctcaacatcactacctgtcatgatgtgctcaatgaa
accctgctcgaaggctactatgcctactacttctcagccttctctgctgtcttctttttt
gtgccgctgatcatttccacggtctgttatgtgtctatcattcgatgtcttagctcttcc
gcagttgccaaccgcagcaagaagtcccgggctttgttcctgtcagctgctgttttctgc
atcttcatcatttgcttcggacccacaaacgtcctcctgattgcgcattactcattcctt
tctcacacttccaccacagaggctgcctactttgcctacctcctctgtgtctgtgtcagc
agcataagctgctgcatcgaccccctaatttactattacgcttcctctgagtgccagagg
tacgtctacagtatcttatgctgcaaagaaagttccgatcccagcagttataacagcagt
gggcagttgatggcaagtaaaatggatacctgctctagtaacctgaataacagcatatac
aaaaagctgttaacttag

KEGG   Homo sapiens (human): 2150
Entry
2150              CDS       T01001                                 

Gene name
F2RL1, GPR11, PAR2
Definition
(RefSeq) F2R like trypsin receptor 1
  KO
K04234  coagulation factor II (thrombin) receptor-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2150 (F2RL1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2150 (F2RL1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    2150 (F2RL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2150 (F2RL1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2150 (F2RL1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 2150
NCBI-ProteinID: NP_005233
OMIM: 600933
HGNC: 3538
Ensembl: ENSG00000164251
Vega: OTTHUMG00000102118
Pharos: P55085(Tchem)
UniProt: P55085
LinkDB
Position
5q13.3
AA seq 397 aa
MRSPSAAWLLGAAILLAASLSCSGTIQGTSRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgcggagccccagcgcggcgtggctgctgggggccgccatcctgctagcagcctctctc
tcctgcagtggcaccatccaaggaaccagtagatcctctaaaggaagaagccttattggt
aaggttgatggcacatcccacgtcactggaaaaggagttacagttgaaacagtcttttct
gtggatgagttttctgcatctgtcctcactggaaaactgaccactgtcttccttccaatt
gtctacacaattgtgtttgtggtgggtttgccaagtaacggcatggccctgtgggtcttt
cttttccgaactaagaagaagcaccctgctgtgatttacatggccaatctggccttggct
gacctcctctctgtcatctggttccccttgaagattgcctatcacatacatggcaacaac
tggatttatggggaagctctttgtaatgtgcttattggctttttctatggcaacatgtac
tgttccattctcttcatgacctgcctcagtgtgcagaggtattgggtcatcgtgaacccc
atggggcactccaggaagaaggcaaacattgccattggcatctccctggcaatatggctg
ctgattctgctggtcaccattcctttgtatgtcgtgaagcagaccatcttcattcctgcc
ctgaacatcacgacctgtcatgatgttttgcctgagcagctcttggtgggagacatgttc
aattacttcctctctctggccattggggtctttctgttcccagccttcctcacagcctct
gcctatgtgctgatgatcagaatgctgcgatcttctgccatggatgaaaactcagagaag
aaaaggaagagggccatcaaactcattgtcactgtcctggccatgtacctgatctgcttc
actcctagtaaccttctgcttgtggtgcattattttctgattaagagccagggccagagc
catgtctatgccctgtacattgtagccctctgcctctctacccttaacagctgcatcgac
ccctttgtctattactttgtttcacatgatttcagggatcatgcaaagaacgctctcctt
tgccgaagtgtccgcactgtaaagcagatgcaagtatccctcacctcaaagaaacactcc
aggaaatccagctcttactcttcaagttcaaccactgttaagacctcctattga

KEGG   Homo sapiens (human): 2151
Entry
2151              CDS       T01001                                 

Gene name
F2RL2, PAR-3, PAR3
Definition
(RefSeq) coagulation factor II thrombin receptor like 2
  KO
K04235  coagulation factor II (thrombin) receptor-like 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2151 (F2RL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    2151 (F2RL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2151 (F2RL2)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2151 (F2RL2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 2151
NCBI-ProteinID: NP_004092
OMIM: 601919
HGNC: 3539
Ensembl: ENSG00000164220
Vega: OTTHUMG00000102119
Pharos: O00254(Tbio)
UniProt: O00254
LinkDB
Position
5q13.3
AA seq 374 aa
MKALIFAAAGLLLLLPTFCQSGMENDTNNLAKPTLPIKTFRGAPPNSFEEFPFSALEGWT
GATITVKIKCPEESASHLHVKNATMGYLTSSLSTKLIPAIYLLVFVVGVPANAVTLWMLF
FRTRSICTTVFYTNLAIADFLFCVTLPFKIAYHLNGNNWVFGEVLCRATTVIFYGNMYCS
ILLLACISINRYLAIVHPFTYRGLPKHTYALVTCGLVWATVFLYMLPFFILKQEYYLVQP
DITTCHDVHNTCESSSPFQLYYFISLAFFGFLIPFVLIIYCYAAIIRTLNAYDHRWLWYV
KASLLILVIFTICFAPSNIILIIHHANYYYNNTDGLYFIYLIALCLGSLNSCLDPFLYFL
MSKTRNHSTAYLTK
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgaaagccctcatctttgcagctgctggcctcctgcttctgttgcccactttttgtcag
agtggcatggaaaatgatacaaacaacttggcaaagccaaccttacccattaagaccttt
cgtggagctcccccaaattcttttgaagagttccccttttctgccttggaaggctggaca
ggagccacgattactgtaaaaattaagtgccctgaagaaagtgcttcacatctccatgtg
aaaaatgctaccatggggtacctgaccagctccttaagtactaaactgatacctgccatc
tacctcctggtgtttgtagttggtgtcccggccaatgctgtgaccctgtggatgcttttc
ttcaggaccagatccatctgtaccactgtattctacaccaacctggccattgcagatttt
cttttttgtgttacattgccctttaagatagcttatcatctcaatgggaacaactgggta
tttggagaggtcctgtgccgggccaccacagtcatcttctatggcaacatgtactgctcc
attctgctccttgcctgcatcagcatcaaccgctacctggccatcgtccatcctttcacc
taccggggcctgcccaagcacacctatgccttggtaacatgtggactggtgtgggcaaca
gttttcttatatatgctgccatttttcatactgaagcaggaatattatcttgttcagcca
gacatcaccacctgccatgatgttcacaacacttgcgagtcctcatctcccttccaactc
tattacttcatctccttggcattctttggattcttaattccatttgtgcttatcatctac
tgctatgcagccatcatccggacacttaatgcatacgatcatagatggttgtggtatgtt
aaggcgagtctcctcatccttgtgatttttaccatttgctttgctccaagcaatattatt
cttattattcaccatgctaactactactacaacaacactgatggcttatattttatatat
ctcatagctttgtgcctgggtagtcttaatagttgcttagatccattcctttattttctc
atgtcaaaaaccagaaatcactccactgcttaccttacaaaatag

KEGG   Homo sapiens (human): 56288
Entry
56288             CDS       T01001                                 

Gene name
PARD3, ASIP, Baz, PAR3, PAR3alpha, PARD-3, PARD3A, PPP1R118, SE2-5L16, SE2-5LT1, SE2-5T2
Definition
(RefSeq) par-3 family cell polarity regulator
  KO
K04237  partitioning defective protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04390  Hippo signaling pathway
hsa04520  Adherens junction
hsa04530  Tight junction
hsa05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    56288 (PARD3)
   04390 Hippo signaling pathway
    56288 (PARD3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    56288 (PARD3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    56288 (PARD3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    56288 (PARD3)
   04530 Tight junction
    56288 (PARD3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    56288 (PARD3)
  09158 Development and regeneration
   04360 Axon guidance
    56288 (PARD3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    56288 (PARD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    56288 (PARD3)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     56288 (PARD3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2 TPR_11
Other DBs
NCBI-GeneID: 56288
NCBI-ProteinID: NP_062565
OMIM: 606745
HGNC: 16051
Ensembl: ENSG00000148498
Vega: OTTHUMG00000017948
Pharos: Q8TEW0(Tbio)
UniProt: Q8TEW0
LinkDB
Structure
PDB: 
2KOM

Position
10p11.22-p11.21
AA seq 1356 aa
MKVTVCFGRTRVVVPCGDGHMKVFSLIQQAVTRYRKAIAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPEIFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALIGLSTSVSDSNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDTSNWSNQFQRDNARSSLSASHPMVGKWLEKQEQDE
DGTEEDNSRVEPVGHADTGLEHIPNFSLDDMVKLVEVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEHENLFRENDCIVRINDGDLRNRRFEQAQHMFRQAMRTPIIWFHVVPA
ANKEQYEQLSQSEKNNYYSSRFSPDSQYIDNRSVNSAGLHTVQRAPRLNHPPEQIDSHSR
LPHSAHPSGKPPSAPASAPQNVFSTTVSSGYNTKKIGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLVGKSQEEVVSLLRSTKMEGTV
SLLVFRQEDAFHPRELNAEPSQMQIPKETKAEDEDIVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKTNQDAME
TLRRSMSTEGNKRGMIQLIVARRISKCNELKSPGSPPGPELPIETALDDRERRISHSLYS
GIEGLDESPSRNAALSRIMGESGKYQLSPTVNMPQDDTVIIEDDRLPVLPPHLSDQSSSS
SHDDVGFVTADAGTWAKAAISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQKAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGDIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPAVDDDDEGMETLEEDTEESSRSGR
ESVSTASDQPSHSLERQMNGNQEKGDKTDRKKDKTGKEKKKDRDKEKDKMKAKKGMLKGL
GDMFRFGKHRKDDKIEKTGKIKIQESFTSEEERIRMKQEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELMYGGVSSYEGSMALNARPQSPREGHMMDALYAQVKKPRNSKPSP
VDSNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQPWPNARPATQSGRHSVSVE
VQMQRQRQEERESSQQAQRQYSSLPRQSRKNASSVSQDSWEQNYSPGEGFQSAKENPRYS
SYQGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQMKKQPPSEGPSNYDSYKKVQDPS
YAPPKGPFRQDVPPSPSQVARLNRLQTPEKGRPFYS
NT seq 4071 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcggacggacccgggtggtcgtgccgtgcggggacggccac
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccatcgccaag
gatccaaactactggatacaggtgcatcgcttggaacatggagatggaggaatactagac
cttgatgacattctttgtgatgtagcagacgataaagacagactggtagcagtgtttgat
gagcaggatccacatcacggaggtgatggcaccagtgccagttccacgggtacccagagc
ccagagatatttggtagtgagcttggcaccaacaatgtctcagcctttcagccttaccaa
gcaacaagtgaaattgaggtcacaccttcagtccttcgagcaaatatgcctcttcatgtt
cgacgcagtagtgacccagctctaattggcctctccacttctgtcagtgatagtaatttt
tcctctgaagagccttcaaggaaaaatcccacacgctggtcaacaacagctggcttcctc
aagcagaacactgctgggagtcctaaaacctgcgacaggaagaaagatgaaaactacaga
agcctcccgcgggatactagtaactggtctaaccaatttcagagagacaatgctcgctcg
tctctgagtgccagtcacccaatggtgggcaagtggctggagaaacaagaacaggatgag
gatgggacagaagaggataacagtcgtgttgaacctgttggacatgctgacacgggtttg
gagcatatacccaacttttctctggatgatatggtaaagctcgtagaagtccccaacgat
ggagggcctctgggaatccacgtagtgcctttcagtgctcgaggcggcagaaccctgggg
ttattagtaaaacgattggagaaaggtggtaaagctgaacatgaaaatctttttcgtgag
aatgattgcattgtcaggattaatgatggcgaccttcgaaatagaagatttgaacaagca
caacatatgtttcgccaagccatgcgtacacccatcatttggttccatgtggttcctgca
gcaaataaagagcagtatgaacaactatcccaaagtgagaagaacaattactattcaagc
cgttttagccctgacagccagtatattgacaacaggagtgtgaacagtgcagggcttcac
acggtgcagagagcaccccgactgaaccacccgcctgagcagatagactctcactcaaga
ctacctcatagcgcacacccctcgggaaaaccaccatccgctccagcctcggcacctcag
aatgtatttagtacgactgtaagcagtggttataacaccaaaaaaataggcaagaggctt
aatatccagcttaagaaaggtacagaaggtttgggattcagcatcacttccagagatgta
acaataggtggctcagctccaatctatgtgaaaaacattctcccccggggggcggccatt
caggatggccgacttaaggcaggagacagacttatagaggtaaatggagtagatttagtg
ggcaaatcccaagaggaagttgtttcgctgttgagaagcaccaagatggaaggaactgtg
agccttctggtctttcgccaggaagacgccttccacccaagggaactgaatgcagagcca
agccagatgcagattccaaaagaaacgaaagcagaagatgaggatattgttcttacacct
gatggcaccagggaatttctgacatttgaagtcccacttaatgattcaggatctgcaggc
cttggtgtcagtgtcaaaggtaaccggtcaaaagagaaccacgcagatttgggaatcttt
gtcaagtccattattaatggaggagcagcatctaaagatggaaggcttcgggtgaatgat
caactgatagcagtaaatggagaatccctgttgggcaagacaaaccaagatgccatggaa
accctaagaaggtctatgtctactgaaggcaataaacgaggaatgatccagcttattgtt
gcaaggagaataagcaagtgcaatgagctgaagtcacctgggagcccccctggacctgag
ctgcccattgaaacagcgttggatgatagagaacgaagaatttcccattccctctacagt
gggattgaggggcttgatgaatcgcccagcagaaatgctgccctcagtaggataatgggt
gagtcaggtaaataccagctgtcccctacagtgaatatgccccaagatgacactgtcatt
atagaagatgacaggttgccagtgcttcctccacatctctctgaccagtcctcttccagc
tcccatgatgatgtggggtttgtgacggcagatgctggtacttgggccaaggctgcaatc
agtgattcagccgactgctctttgagtccagatgttgatccagttcttgcttttcaacga
gaaggatttggacgtcagagtatgtcagaaaaacgcacaaagcaattttcagatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagaaagcaggttctcccagcagagatgtgggtcct
tccctgggtctgaagaagtcaagctcgttggagagtctgcagaccgcagttgccgaggtg
actttgaatggggatattcctttccatcgtccacggccgcggataatcagaggcagggga
tgcaatgagagcttcagagctgccatcgacaaatcttatgataaacccgcggtagatgat
gatgatgaaggcatggagaccttggaagaagacacagaagaaagttcaagatcagggaga
gagtctgtatccacagccagtgatcagccttcccactctctggagagacaaatgaatgga
aaccaagagaaaggtgataagactgatagaaaaaaggataaaactggaaaagaaaagaag
aaagatagagataaggagaaggataaaatgaaagccaagaagggaatgctgaagggcttg
ggagacatgttcaggtttggcaaacatcgaaaagatgacaagattgagaaaacgggtaaa
ataaaaatacaggaatcctttacatcagaagaggagaggatacgaatgaagcaggagcag
gagaggattcaagccaaaactcgagaatttagggaacgacaagctcgagagcgtgactat
gctgaaattcaagattttcatcggacatttggctgtgatgatgagttaatgtatggggga
gtttcttcttatgaaggttccatggctctcaacgctagacctcagagcccacgagaaggg
catatgatggatgctttgtatgcccaagtcaagaagccgcggaattccaaaccctcacct
gtagacagtaacagatcaactcctagcaatcatgatcggatacagcgtctgaggcaagaa
tttcagcaagcaaagcaagatgaagatgtagaagatcgtcggcggacctatagttttgag
caaccctggccgaacgcacggccggcgacgcagagcgggcgacactcggtgtccgtggag
gtgcagatgcagcggcagcggcaggaggagcgcgagagctcccagcaggcccagcgccag
tacagctctctgcctcggcaaagcaggaaaaatgccagctcggtctcccaggactcttgg
gagcagaactactcccctggggaaggcttccagagtgccaaagagaaccccaggtactcc
agctaccaaggctccaggaacggctacctgggaggacatggcttcaacgccagggtcatg
ctggaaactcaggagctccttcgccaggaacagaggcggaaggagcagcagatgaagaag
cagcctccttccgaggggcccagcaactatgactcgtataagaaagtccaggaccccagt
tacgcccctcccaaggggcccttccggcaagatgtgcccccctccccttctcaggttgcg
aggctgaacagacttcagactcctgagaaagggaggcccttctattcctga

KEGG   Homo sapiens (human): 9002
Entry
9002              CDS       T01001                                 

Gene name
F2RL3, PAR4
Definition
(RefSeq) F2R like thrombin or trypsin receptor 3
  KO
K04236  coagulation factor II (thrombin) receptor-like 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04610  Complement and coagulation cascades
hsa04611  Platelet activation
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    9002 (F2RL3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    9002 (F2RL3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    9002 (F2RL3)
   04611 Platelet activation
    9002 (F2RL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    9002 (F2RL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    9002 (F2RL3)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    9002 (F2RL3)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srw
Other DBs
NCBI-GeneID: 9002
NCBI-ProteinID: NP_003941
OMIM: 602779
HGNC: 3540
Ensembl: ENSG00000127533
Vega: OTTHUMG00000182647
Pharos: Q96RI0(Tchem)
UniProt: Q96RI0
LinkDB
Position
19p13.11
AA seq 385 aa
MWGRLLLWPLVLGFSLSGGTQTPSVYDESGSTGGGDDSTPSILPAPRGYPGQVCANDSDT
LELPDSSRALLLGWVPTRLVPALYGLVLVVGLPANGLALWVLATQAPRLPSTMLLMNLAA
ADLLLALALPPRIAYHLRGQRWPFGEAACRLATAALYGHMYGSVLLLAAVSLDRYLALVH
PLRARALRGRRLALGLCMAAWLMAAALALPLTLQRQTFRLARSDRVLCHDALPLDAQASH
WQPAFTCLALLGCFLPLLAMLLCYGATLHTLAASGRRYGHALRLTAVVLASAVAFFVPSN
LLLLLHYSDPSPSAWGNLYGAYVPSLALSTLNSCVDPFIYYYVSAEFRDKVRAGLFQRSP
GDTVASKASAEGGSRGMGTHSSLLQ
NT seq 1158 nt   +upstreamnt  +downstreamnt
atgtgggggcgactgctcctgtggcccctggtgctggggttcagcctgtctggcggcacc
cagacccccagcgtctacgacgagagcgggagcaccggaggtggtgatgacagcacgccc
tcaatcctgcctgccccccgcggctacccaggccaagtctgtgccaatgacagtgacacc
ctggagctcccggacagctcacgggcactgcttctgggctgggtgcccaccaggctggtg
cccgccctctatgggctggtcctggtggtggggctgccggccaatgggctggcgctgtgg
gtgctggccacgcaggcacctcggctgccctccaccatgctgctgatgaacctcgcggct
gctgacctcctgctggccctggcgctgcccccgcggatcgcctaccacctgcgtggccag
cgctggcccttcggggaggccgcctgccgcctggccacggccgcactctatggtcacatg
tatggctcagtgctgctgctggccgccgtcagcctggatcgctacctggccctggtgcac
ccgctgcgggcccgcgccctgcgtggccggcgcctggcccttggactctgcatggctgct
tggctcatggcggccgccctggcactgcccctgacactgcagcggcagaccttccggctg
gcgcgctccgatcgcgtgctctgccatgacgcgctgcccctggacgcacaggcctcccac
tggcaaccggccttcacctgcctggcgctgttgggctgtttcctgcccctgctggccatg
ctgctgtgctacggggccaccctgcacacgctggcggccagcggccggcgctacggccac
gcgctgaggctgaccgcagtggtgctggcctccgccgtggccttcttcgtgcccagcaac
ctgctgctgctgctgcattactcggacccgagccccagcgcctggggcaacctctatggt
gcctacgtgcccagcctggcgctgagcaccctcaacagctgcgtggatcccttcatctac
tactacgtgtcggccgagttcagggacaaggtgcgggcagggctcttccaacggtcgccg
ggggacaccgtggcctccaaggcctctgcggaagggggcagccggggcatgggcacccac
tcctctttgctccagtga

DBGET integrated database retrieval system