KEGG   Homo sapiens (human): 2150Help
Entry
2150              CDS       T01001                                 

Gene name
F2RL1, GPR11, PAR2
Definition
(RefSeq) F2R like trypsin receptor 1
  KO
K04234  coagulation factor II (thrombin) receptor-like 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa05143  African trypanosomiasis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2150 (F2RL1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    2150 (F2RL1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    2150 (F2RL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    2150 (F2RL1)
G protein-coupled receptors [BR:hsa04030]
 Rhodopsin family
  Peptide
   Thrombin
    2150 (F2RL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srw
Motif
Other DBs
NCBI-GeneID: 2150
NCBI-ProteinID: NP_005233
OMIM: 600933
HGNC: 3538
Ensembl: ENSG00000164251
Vega: OTTHUMG00000102118
Pharos: P55085(Tchem)
UniProt: P55085
LinkDB All DBs
Position
5q13.3
AA seq 397 aa AA seqDB search
MRSPSAAWLLGAAILLAASLSCSGTIQGTSRSSKGRSLIGKVDGTSHVTGKGVTVETVFS
VDEFSASVLTGKLTTVFLPIVYTIVFVVGLPSNGMALWVFLFRTKKKHPAVIYMANLALA
DLLSVIWFPLKIAYHIHGNNWIYGEALCNVLIGFFYGNMYCSILFMTCLSVQRYWVIVNP
MGHSRKKANIAIGISLAIWLLILLVTIPLYVVKQTIFIPALNITTCHDVLPEQLLVGDMF
NYFLSLAIGVFLFPAFLTASAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICF
TPSNLLLVVHYFLIKSQGQSHVYALYIVALCLSTLNSCIDPFVYYFVSHDFRDHAKNALL
CRSVRTVKQMQVSLTSKKHSRKSSSYSSSSTTVKTSY
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgcggagccccagcgcggcgtggctgctgggggccgccatcctgctagcagcctctctc
tcctgcagtggcaccatccaaggaaccagtagatcctctaaaggaagaagccttattggt
aaggttgatggcacatcccacgtcactggaaaaggagttacagttgaaacagtcttttct
gtggatgagttttctgcatctgtcctcactggaaaactgaccactgtcttccttccaatt
gtctacacaattgtgtttgtggtgggtttgccaagtaacggcatggccctgtgggtcttt
cttttccgaactaagaagaagcaccctgctgtgatttacatggccaatctggccttggct
gacctcctctctgtcatctggttccccttgaagattgcctatcacatacatggcaacaac
tggatttatggggaagctctttgtaatgtgcttattggctttttctatggcaacatgtac
tgttccattctcttcatgacctgcctcagtgtgcagaggtattgggtcatcgtgaacccc
atggggcactccaggaagaaggcaaacattgccattggcatctccctggcaatatggctg
ctgattctgctggtcaccattcctttgtatgtcgtgaagcagaccatcttcattcctgcc
ctgaacatcacgacctgtcatgatgttttgcctgagcagctcttggtgggagacatgttc
aattacttcctctctctggccattggggtctttctgttcccagccttcctcacagcctct
gcctatgtgctgatgatcagaatgctgcgatcttctgccatggatgaaaactcagagaag
aaaaggaagagggccatcaaactcattgtcactgtcctggccatgtacctgatctgcttc
actcctagtaaccttctgcttgtggtgcattattttctgattaagagccagggccagagc
catgtctatgccctgtacattgtagccctctgcctctctacccttaacagctgcatcgac
ccctttgtctattactttgtttcacatgatttcagggatcatgcaaagaacgctctcctt
tgccgaagtgtccgcactgtaaagcagatgcaagtatccctcacctcaaagaaacactcc
aggaaatccagctcttactcttcaagttcaaccactgttaagacctcctattga

DBGET integrated database retrieval system