KEGG   Homo sapiens (human): 2185
Entry
2185              CDS       T01001                                 

Gene name
PTK2B, CADTK, CAKB, FADK2, FAK2, PKB, PTK, PYK2, RAFTK
Definition
(RefSeq) protein tyrosine kinase 2 beta
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04062  Chemokine signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04670  Leukocyte transendothelial migration
hsa04912  GnRH signaling pathway
hsa05135  Yersinia infection
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05170  Human immunodeficiency virus 1 infection
Network
nt06110  MAPK signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
nt06263  Hepatocellular carcinoma
  Element
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
Drug target
Defactinib (DG01827): D10618 D10619
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    2185 (PTK2B)
   04072 Phospholipase D signaling pathway
    2185 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2185 (PTK2B)
   04670 Leukocyte transendothelial migration
    2185 (PTK2B)
   04062 Chemokine signaling pathway
    2185 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    2185 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    2185 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    2185 (PTK2B)
   05161 Hepatitis B
    2185 (PTK2B)
   05163 Human cytomegalovirus infection
    2185 (PTK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2185 (PTK2B)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2185 (PTK2B)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FAK family
   2185 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 2185
NCBI-ProteinID: NP_004094
OMIM: 601212
HGNC: 9612
Ensembl: ENSG00000120899
Vega: OTTHUMG00000102082
Pharos: Q14289(Tchem)
UniProt: Q14289
LinkDB
Structure
PDB: 

Position
8p21.2
AA seq 1009 aa
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIRLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDVYQMEKDIAMEQERNARYRTPKILEPTAFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIQPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagtcgagtaaagttgggcacgttacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaggacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaaaaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccggttggctgagtgctatgggctgaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccagaagacttc
atggagagcctgaaggaggacaggaccacgctgctctatttttaccaacagctccggaac
gactacatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgccggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccgctggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcatccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggtgagcaccaaggc
tctctcatcatccatcctaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacctctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcccggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaatgtagctgtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgccgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggagaccggctgcccaagcctgatctctgtccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacgtttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacagccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccgcaaaccaacctcctggctccaaagctgcagttccaggttcct
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccaacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aaggtcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacctggagttcacagggcccccacagaagcccccg
aggctgggcgcacagtccatccagcccacagctaacctggaccggactgatgacctggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctacgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagcgtggatgatctcctgccttccttgccgtcatcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggca
cagcagaacgccgtgacctccctaagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggctgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

KEGG   Homo sapiens (human): 5747
Entry
5747              CDS       T01001                                 

Gene name
PTK2, FADK, FAK, FAK1, FRNK, PPP1R71, p125FAK, pp125FAK
Definition
(RefSeq) protein tyrosine kinase 2
  KO
K05725  focal adhesion kinase 1 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04062  Chemokine signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04670  Leukocyte transendothelial migration
hsa04810  Regulation of actin cytoskeleton
hsa04935  Growth hormone synthesis, secretion and action
hsa05100  Bacterial invasion of epithelial cells
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05146  Amoebiasis
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05170  Human immunodeficiency virus 1 infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05205  Proteoglycans in cancer
hsa05222  Small cell lung cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06124  Chemokine signaling (viruses)
nt06135  Cytoskeletal regulation (viruses)
nt06167  Human cytomegalovirus (HCMV)
nt06240  Transcription
  Element
N00131  Amplified MYCN to transcriptional activation
N00413  CXCR4-GNB/G-PLCB-PKC signaling pathway
N00414  HCMV US27 to CXCR4-GNB/G-PLCB-PKC signaling pathway
N01068  ITGA/B-FAK-RAC signaling pathway
N01070  ITGA/B-FAK-CDC42 signaling pathway
N01072  ITGA/B-RhoGEF-RhoA signaling pathway
N01080  ITGA/B-TALIN/VINCULIN signaling pathway
N01081  Shigella IpaB/C/D to ITGA/B-TALIN/VINCULIN signaling pathway
N01083  Shigella OspE to ITGA/B-TALIN/VINCULIN signaling pathway
N01111  Yersinia YopH to ITGA/B-FAK-RAC signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    5747 (PTK2)
   04370 VEGF signaling pathway
    5747 (PTK2)
   04151 PI3K-Akt signaling pathway
    5747 (PTK2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5747 (PTK2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5747 (PTK2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    5747 (PTK2)
   04062 Chemokine signaling pathway
    5747 (PTK2)
  09152 Endocrine system
   04935 Growth hormone synthesis, secretion and action
    5747 (PTK2)
  09158 Development and regeneration
   04360 Axon guidance
    5747 (PTK2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5747 (PTK2)
   05202 Transcriptional misregulation in cancer
    5747 (PTK2)
   05205 Proteoglycans in cancer
    5747 (PTK2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    5747 (PTK2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5747 (PTK2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    5747 (PTK2)
   05135 Yersinia infection
    5747 (PTK2)
   05100 Bacterial invasion of epithelial cells
    5747 (PTK2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    5747 (PTK2)
   05163 Human cytomegalovirus infection
    5747 (PTK2)
   05165 Human papillomavirus infection
    5747 (PTK2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    5747 (PTK2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    5747 (PTK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5747 (PTK2)
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    5747 (PTK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     5747 (PTK2)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FAK family
   5747 (PTK2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     5747 (PTK2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT Pkinase FERM_N_2 FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 5747
NCBI-ProteinID: NP_722560
OMIM: 600758
HGNC: 9611
Ensembl: ENSG00000169398
Vega: OTTHUMG00000067438
Pharos: Q05397(Tchem)
UniProt: Q05397 Q658W2 Q59GM6
LinkDB
Structure
PDB: 

Position
8q24.3
AA seq 1052 aa
MAAAYLDPNLNHTPNSSTKTHLGTGMERSPGAMERVLKVFHYFESNSEPTTWASIIRHGD
ATDVRGIIQKIVDSHKVKHVACYGFRLSHLRSEEVHWLHVDMGVSSVREKYELAHPPEEW
KYELRIRYLPKGFLNQFTEDKPTLNFFYQQVKSDYMLEIADQVDQEIALKLGCLEIRRSY
WEMRGNALEKKSNYEVLEKDVGLKRFFPKSLLDSVKAKTLRKLIQQTFRQFANLNREESI
LKFFEILSPVYRFDKECFKCALGSSWIISVELAIGPEEGISYLTDKGCNPTHLADFTQVQ
TIQYSNSEDKDRKGMLQLKIAGAPEPLTVTAPSLTIAENMADLIDGYCRLVNGTSQSFII
RPQKEGERALPSIPKLANSEKQGMRTHAVSVSETDDYAEIIDEEDTYTMPSTRDYEIQRE
RIELGRCIGEGQFGDVHQGIYMSPENPALAVAIKTCKNCTSDSVREKFLQEALTMRQFDH
PHIVKLIGVITENPVWIIMELCTLGELRSFLQVRKYSLDLASLILYAYQLSTALAYLESK
RFVHRDIAARNVLVSSNDCVKLGDFGLSRYMEDSTYYKASKGKLPIKWMAPESINFRRFT
SASDVWMFGVCMWEILMHGVKPFQGVKNNDVIGRIENGERLPMPPNCPPTLYSLMTKCWA
YDPSRRPRFTELKAQLSTILEEEKAQQEERMRMESRRQATVSWDSGGSDEAPPKPSRPGY
PSPRSSEGFYPSPQHMVQTNHYQVSGYPGSHGITAMAGSIYPGQASLLDQTDSWNHRPQE
IAMWQPNVEDSTVLDLRGIGQVLPTHLMEERLIRQQQEMEEDQRWLEKEERFLKPDVRLS
RGSIDREDGSLQGPIGNQHIYQPVGKPDPAAPPKKPPRPGAPGHLGSLASLSSPADSYNE
GVKLQPQEISPPPTANLDRSNDKVYENVTGLVKAVIEMSSKIQPAPPEEYVPMVKEVGLA
LRTLLATVDETIPLLPASTHREIEMAQKLLNSDLGELINKMKLAQQYVMTSLQQEYKKQM
LTAAHALAVDAKNLLDVIDQARLKMLGQTRPH
NT seq 3159 nt   +upstreamnt  +downstreamnt
atggcagctgcttaccttgaccccaacttgaatcacacaccaaattcgagtactaagact
cacctgggtactggtatggaacgttctcctggtgcaatggagcgagtattaaaggtcttt
cattattttgaaagcaatagtgagccaaccacctgggccagtattatcaggcatggagat
gctactgatgtcaggggcatcattcagaagatagtggacagtcacaaagtaaagcatgtg
gcctgctatggattccgcctcagtcacctgcggtcagaggaggttcactggcttcacgtg
gatatgggcgtctccagtgtgagggagaagtatgagcttgctcacccaccagaggagtgg
aaatatgaattgagaattcgttatttgccaaaaggatttctaaaccagtttactgaagat
aagccaactttgaatttcttctatcaacaggtgaagagcgattatatgttagagatagct
gatcaagtggaccaggaaattgctttgaagttgggttgtctagaaatacggcgatcatac
tgggagatgcggggcaatgcactagaaaagaagtctaactatgaagtattagaaaaagat
gttggtttaaagcgattttttcctaagagtttactggattctgtcaaggccaaaacacta
agaaaactgatccaacaaacatttagacaatttgccaaccttaatagagaagaaagtatt
ctgaaattctttgagatcctgtctccagtctacagatttgataaggaatgcttcaagtgt
gctcttggttcaagctggattatttcagtggaactggcaatcggcccagaagaaggaatc
agttacctaacggacaagggctgcaatcccacacatcttgctgacttcactcaagtgcaa
accattcagtattcaaacagtgaagacaaggacagaaaaggaatgctacaactaaaaata
gcaggtgcacccgagcctctgacagtgacggcaccatccctaaccattgcggagaatatg
gctgacctaatagatgggtactgccggctggtgaatggaacctcgcagtcatttatcatc
agacctcagaaagaaggtgaacgggctttgccatcaataccaaagttggccaacagcgaa
aagcaaggcatgcggacacacgccgtctctgtgtcagaaacagatgattatgctgagatt
atagatgaagaagatacttacaccatgccctcaaccagggattatgagattcaaagagaa
agaatagaacttggacgatgtattggagaaggccaatttggagatgtacatcaaggcatt
tatatgagtccagagaatccagctttggcggttgcaattaaaacatgtaaaaactgtact
tcggacagcgtgagagagaaatttcttcaagaagccttaacaatgcgtcagtttgaccat
cctcatattgtgaagctgattggagtcatcacagagaatcctgtctggataatcatggag
ctgtgcacacttggagagctgaggtcatttttgcaagtaaggaaatacagtttggatcta
gcatctttgatcctgtatgcctatcagcttagtacagctcttgcatatctagagagcaaa
agatttgtacacagggacattgctgctcggaatgttctggtgtcctcaaatgattgtgta
aaattaggagactttggattatcccgatatatggaagatagtacttactacaaagcttcc
aaaggaaaattgcctattaaatggatggctccagagtcaatcaattttcgacgttttacc
tcagctagtgacgtatggatgtttggtgtgtgtatgtgggagatactgatgcatggtgtg
aagccttttcaaggagtgaagaacaatgatgtaatcggtcgaattgaaaatggggaaaga
ttaccaatgcctccaaattgtcctcctaccctctacagccttatgacgaaatgctgggcc
tatgaccccagcaggcggcccaggtttactgaacttaaagctcagctcagcacaatcctg
gaggaagagaaggctcagcaagaagagcgcatgaggatggagtccagaagacaggccaca
gtgtcctgggactccggagggtctgatgaagcaccgcccaagcccagcagaccgggttat
cccagtccgaggtccagcgaaggattttatcccagcccacagcacatggtacaaaccaat
cattaccaggtttctggctaccctggttcacatggaatcacagccatggctggcagcatc
tatccaggtcaggcatctcttttggaccaaacagattcatggaatcatagacctcaggag
atagcaatgtggcagcccaatgtggaggactctacagtattggacctgcgagggattggg
caagtgttgccaacccatctgatggaagagcgtctaatccgacagcaacaggaaatggaa
gaagatcagcgctggctggaaaaagaggaaagatttctgaaacctgatgtgagactctct
cgaggcagtattgacagggaggatggaagtcttcagggtccgattggaaaccaacatata
tatcagcctgtgggtaaaccagatcctgcagctccaccaaagaaaccgcctcgccctgga
gctcccggtcatctgggaagccttgccagcctcagcagccctgctgacagctacaacgag
ggtgtcaagcttcagccccaggaaatcagcccccctcctactgccaacctggaccggtcg
aatgataaggtgtacgagaatgtgacgggcctggtgaaagctgtcatcgagatgtccagt
aaaatccagccagccccaccagaggagtatgtccctatggtgaaggaagtcggcttggcc
ctgaggacattattggccactgtggatgagaccattcccctcctaccagccagcacccac
cgagagattgagatggcacagaagctattgaactctgacctgggtgagctcatcaacaag
atgaaactggcccagcagtatgtcatgaccagcctccagcaagagtacaaaaagcaaatg
ctgactgctgctcacgccctggctgtggatgccaaaaacttactcgatgtcattgaccaa
gcaagactgaaaatgcttgggcagacgagaccacactga

DBGET integrated database retrieval system