KEGG   Homo sapiens (human): 219988
Entry
219988            CDS       T01001                                 

Gene name
PATL1, Pat1b, hPat1b
Definition
(RefSeq) PAT1 homolog 1, processing body mRNA decay factor
  KO
K12617  DNA topoisomerase 2-associated protein PAT1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    219988 (PATL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    219988 (PATL1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     219988 (PATL1)
  mRNA degradation factors
   5'-3' decay
    Decapping complex
     219988 (PATL1)
SSDB
Motif
Pfam: PAT1
Other DBs
NCBI-GeneID: 219988
NCBI-ProteinID: NP_689929
OMIM: 614660
HGNC: 26721
Ensembl: ENSG00000166889
Vega: OTTHUMG00000167423
Pharos: Q86TB9(Tbio)
UniProt: Q86TB9
LinkDB
Structure
PDB: 
2XES 2XER 2XEQ

Position
11q12.1
AA seq 770 aa
MFRYESLEDCPLDEDEDAFQGLGEEDEEIDQFNDDTFGSGAVDDDWQEAHERLAELEEKL
PVAVNEQTGNGERDEMDLLGDHEENLAERLSKMVIENELEDPAIMRAVQTRPVLQPQPGS
LNSSIWDGSEVLRRIRGPLLAQEMPTVSVLEYALPQRPPQGPEDDRDLSERALPRRSTSP
IIGSPPVRAVPIGTPPKQMAVPSFTQQILCPKPVHVRPPMPPRYPAPYGERMSPNQLCSV
PNSSLLGHPFPPSVPPVLSPLQRAQLLGGAQLQPGRMSPSQFARVPGFVGSPLAAMNPKL
LQGRVGQMLPPAPGFRAFFSAPPSATPPPQQHPPGPGPHLQNLRSQAPMFRPDTTHLHPQ
HRRLLHQRQQQNRSQHRNLNGAGDRGSHRSSHQDHLRKDPYANLMLQREKDWVSKIQMMQ
LQSTDPYLDDFYYQNYFEKLEKLSAAEEIQGDGPKKERTKLITPQVAKLEHAYKPVQFEG
SLGKLTVSSVNNPRKMIDAVVTSRSEDDETKEKQVRDKRRKTLVIIEKTYSLLLDVEDYE
RRYLLSLEEERPALMDDRKHKICSMYDNLRGKLPGQERPSDDHFVQIMCIRKGKRMVARI
LPFLSTEQAADILMTTARNLPFLIKKDAQDEVLPCLLSPFSLLLYHLPSVSITSLLRQLM
NLPQSAATPALSNPHLTAVLQNKFGLSLLLILLSRGEDLQSSDPATESTQNNQWTEVMFM
ATRELLRIPQAALAKPISIPTNLVSLFSRYVDRQKLNLLETKLQLVQGIR
NT seq 2313 nt   +upstreamnt  +downstreamnt
atgttccgctacgagtctttggaggattgtcctctggatgaagatgaagatgcatttcag
ggactgggagaagaagatgaagagattgatcaattcaatgatgatacatttgggtcaggt
gcagttgatgatgattggcaggaagcacatgagcgcctggctgaattggaagaaaagcta
ccagtggcagttaatgaacaaacaggcaatggagagagagatgaaatggacttgttgggt
gaccatgaggagaatctggcagaaaggctcagtaagatggtgattgaaaatgaactagaa
gatccagctattatgagggcagtgcagaccaggccagttttacaaccccaaccaggaagt
ctgaattccagtatctgggatggatctgaagttctgaggcgaatccgaggaccactgctt
gctcaggaaatgcctacagtgtctgtattagaatatgctttgcctcagaggcccccccag
ggtccagaagatgatcgggacctttctgaacgagcattaccaaggcggtcaacttcacct
atcattggcagtcctcctgttagagctgtccccataggcaccccacctaaacagatggct
gtacccagcttcacccaacagattctgtgtccgaagcctgtccatgttcggcccccaatg
ccacctcgttatcctgctccctatggtgagaggatgtctccaaaccagctctgcagtgtc
ccgaactcttccctcctgggtcacccttttcctcctagtgttcctcctgttctcagcccc
ctccagagagcacagcttcttggaggagcacagctacagcctggacggatgtctcccagc
cagtttgcacgggtccctggatttgttggtagtccacttgctgccatgaatcccaagttg
ctacaagggcgagttgggcagatgcttcccccagcaccaggcttccgtgccttctttagt
gctccaccctccgctacaccacctccacagcagcaccctcctggcccaggaccccacctg
caaaacctaagatctcaggccccaatgtttagaccggacacaactcacctccatccacag
caccgtcgactcttgcatcagagacagcaacagaatagaagtcagcatcggaatctcaat
ggtgcgggagatagaggaagtcaccggagcagtcatcaagatcatctccgaaaggatcca
tatgccaatctcatgttgcagcgggaaaaggattgggtctctaaaatccagatgatgcaa
ctgcaaagcactgatccctacctggatgatttttattaccagaattactttgaaaaactg
gagaaactgtcagctgctgaagaaatacaaggtgatggccctaagaaggagcgcaccaag
cttatcacccctcaggtggccaaactggagcacgcctataagccagtgcaatttgagggc
tctttgggaaagcttaccgtttctagtgtgaataatccccgaaaaatgattgatgctgtt
gtgacatctcggagtgaggatgatgagacaaaagaaaaacaagttcgagacaagaggaga
aaaacccttgttataattgagaaaacctacagcttactccttgatgtggaggactatgaa
agacgttatctcctaagtctggaagaagagcgacctgccctaatggatgacagaaagcac
aaaatttgtagcatgtatgacaacttaagggggaaattgcctggacaagagaggcctagt
gatgaccactttgtacagatcatgtgtatccgaaaagggaagagaatggttgcccgtatt
cttcctttcctctccacagagcaagcagctgacattctcatgacaacagccaggaacctc
cctttccttatcaagaaggatgcacaagatgaggtgctgccatgcttactgagtcccttc
tctctccttctctatcatcttccatcagtgagtatcaccagccttttgcgacagctaatg
aacctacctcaaagtgcagctacaccagcactctccaatcctcacctcactgctgtgctc
cagaacaagtttggcctgtcactgctcctcatcctcctgagccgtggtgaagacctacag
agttcagaccctgctacagaatcaacacaaaataatcagtggacggaggtgatgttcatg
gcaacacgagaacttctgcggattccccaagcagccctggccaagccaatctctatacct
acaaacctagtgtccctcttttctcgctatgttgaccggcagaaactgaacttgctggag
acaaaactgcagctagttcaggggatacgataa

DBGET integrated database retrieval system