KEGG   Homo sapiens (human): 2205
Entry
2205              CDS       T01001                                 

Gene name
FCER1A, FCE1A, FcERI
Definition
(RefSeq) Fc fragment of IgE receptor Ia
  KO
K08089  high affinity immunoglobulin epsilon receptor subunit alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma
Drug target
Benzylpenicilloyl polylysine: D03095<US>
Omalizumab: D05251<JP/US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2205 (FCER1A)
   04071 Sphingolipid signaling pathway
    2205 (FCER1A)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    2205 (FCER1A)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    2205 (FCER1A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig V-set Ig_4 Ig_5 I-set Izumo-Ig Ig_6 C2-set Adeno_E3_CR1 C1-set TadE
Other DBs
NCBI-GeneID: 2205
NCBI-ProteinID: NP_001992
OMIM: 147140
HGNC: 3609
Ensembl: ENSG00000179639
Vega: OTTHUMG00000037176
Pharos: P12319(Tbio)
UniProt: P12319
LinkDB
Structure
PDB: 

Position
1q23.2
AA seq 257 aa
MAPAMESPTLLCVALLFFAPDGVLAVPQKPKVSLNPPWNRIFKGENVTLTCNGNNFFEVS
STKWFHNGSLSEETNSSLNIVNAKFEDSGEYKCQHQQVNESEPVYLEVFSDWLLLQASAE
VVMEGQPLFLRCHGWRNWDVYKVIYYKDGEALKYWYENHNISITNATVEDSGTYYCTGKV
WQLDYESEPLNITVIKAPREKYWLQFFIPLLVVILFAVDTGLFISTQQQVTFLLKIKRTR
KGFRLLNPHPKPNPKNN
NT seq 774 nt   +upstreamnt  +downstreamnt
atggctcctgccatggaatcccctactctactgtgtgtagccttactgttcttcgctcca
gatggcgtgttagcagtccctcagaaacctaaggtctccttgaaccctccatggaataga
atatttaaaggagagaatgtgactcttacatgtaatgggaacaatttctttgaagtcagt
tccaccaaatggttccacaatggcagcctttcagaagagacaaattcaagtttgaatatt
gtgaatgccaaatttgaagacagtggagaatacaaatgtcagcaccaacaagttaatgag
agtgaacctgtgtacctggaagtcttcagtgactggctgctccttcaggcctctgctgag
gtggtgatggagggccagcccctcttcctcaggtgccatggttggaggaactgggatgtg
tacaaggtgatctattataaggatggtgaagctctcaagtactggtatgagaaccacaac
atctccattacaaatgccacagttgaagacagtggaacctactactgtacgggcaaagtg
tggcagctggactatgagtctgagcccctcaacattactgtaataaaagctccgcgtgag
aagtactggctacaattttttatcccattgttggtggtgattctgtttgctgtggacaca
ggattatttatctcaactcagcagcaggtcacatttctcttgaagattaagagaaccagg
aaaggcttcagacttctgaacccacatcctaagccaaaccccaaaaacaactga

KEGG   Homo sapiens (human): 2206
Entry
2206              CDS       T01001                                 

Gene name
MS4A2, APY, ATOPY, FCER1B, FCERI, IGEL, IGER, IGHER, MS4A1
Definition
(RefSeq) membrane spanning 4-domains A2
  KO
K08090  high affinity immunoglobulin epsilon receptor subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa05310  Asthma
Disease
H00079  Asthma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2206 (MS4A2)
   04071 Sphingolipid signaling pathway
    2206 (MS4A2)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    2206 (MS4A2)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    2206 (MS4A2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    2206 (MS4A2)
Transporters [BR:hsa02000]
 Other transporters
  Pores ion channels [TC:1]
   2206 (MS4A2)
SSDB
Motif
Pfam: CD20
Other DBs
NCBI-GeneID: 2206
NCBI-ProteinID: NP_000130
OMIM: 147138
HGNC: 7316
Ensembl: ENSG00000149534
Vega: OTTHUMG00000167239
Pharos: Q01362(Tbio)
UniProt: Q01362
LinkDB
Position
11q12.1
AA seq 244 aa
MDTESNRRANLALPQEPSSVPAFEVLEISPQEVSSGRLLKSASSPPLHTWLTVLKKEQEF
LGVTQILTAMICLCFGTVVCSVLDISHIEGDIFSSFKAGYPFWGAIFFSISGMLSIISER
RNATYLVRGSLGANTASSIAGGTGITILIINLKKSLAYIHIHSCQKFFETKCFMASFSTE
IVVMMLFLTILGLGSAVSLTICGAGEELKGNKVPEDRVYEELNIYSATYSELEDPGEMSP
PIDL
NT seq 735 nt   +upstreamnt  +downstreamnt
atggacacagaaagtaataggagagcaaatcttgctctcccacaggagccttccagtgtg
cctgcatttgaagtcttggaaatatctccccaggaagtatcttcaggcagactattgaag
tcggcctcatccccaccactgcatacatggctgacagttttgaaaaaagagcaggagttc
ctgggggtaacacaaattctgactgctatgatatgcctttgttttggaacagttgtctgc
tctgtacttgatatttcacacattgagggagacattttttcatcatttaaagcaggttat
ccattctggggagccatatttttttctatttctggaatgttgtcaattatatctgaaagg
agaaatgcaacatatctggtgagaggaagcctgggagcaaacactgccagcagcatagct
gggggaacgggaattaccatcctgatcatcaacctgaagaagagcttggcctatatccac
atccacagttgccagaaattttttgagaccaagtgctttatggcttccttttccactgaa
attgtagtgatgatgctgtttctcaccattctgggacttggtagtgctgtgtcactcaca
atctgtggagctggggaagaactcaaaggaaacaaggttccagaggatcgtgtttatgaa
gaattaaacatatattcagctacttacagtgagttggaagacccaggggaaatgtctcct
cccattgatttataa

KEGG   Homo sapiens (human): 2207
Entry
2207              CDS       T01001                                 

Gene name
FCER1G, FCRG
Definition
(RefSeq) Fc fragment of IgE receptor Ig
  KO
K07983  high affinity immunoglobulin epsilon receptor subunit gamma
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04664  Fc epsilon RI signaling pathway
hsa05152  Tuberculosis
hsa05310  Asthma
Drug target
Benzylpenicilloyl polylysine: D03095<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2207 (FCER1G)
   04071 Sphingolipid signaling pathway
    2207 (FCER1G)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2207 (FCER1G)
   04625 C-type lectin receptor signaling pathway
    2207 (FCER1G)
   04650 Natural killer cell mediated cytotoxicity
    2207 (FCER1G)
   04664 Fc epsilon RI signaling pathway
    2207 (FCER1G)
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    2207 (FCER1G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    2207 (FCER1G)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    2207 (FCER1G)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   2207 (FCER1G)
SSDB
Motif
Pfam: TCR_zetazeta ITAM
Other DBs
NCBI-GeneID: 2207
NCBI-ProteinID: NP_004097
OMIM: 147139
HGNC: 3611
Ensembl: ENSG00000158869
Vega: OTTHUMG00000034343
Pharos: P30273(Tbio)
UniProt: P30273
LinkDB
Position
1q23.3
AA seq 86 aa
MIPAVVLLLLLLVEQAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEK
SDGVYTGLSTRNQETYETLKHEKPPQ
NT seq 261 nt   +upstreamnt  +downstreamnt
atgattccagcagtggtcttgctcttactccttttggttgaacaagcagcggccctggga
gagcctcagctctgctatatcctggatgccatcctgtttctgtatggaattgtcctcacc
ctcctctactgtcgactgaagatccaagtgcgaaaggcagctataaccagctatgagaaa
tcagatggtgtttacacgggcctgagcaccaggaaccaggagacttacgagactctgaag
catgagaaaccaccacagtag

DBGET integrated database retrieval system