KEGG   Homo sapiens (human): 2209Help
Entry
2209              CDS       T01001                                 

Gene name
FCGR1A, CD64, CD64A, FCRI, IGFR1
Definition
(RefSeq) Fc fragment of IgG receptor Ia
  KO
K06498  high affinity immunoglobulin gamma Fc receptor I
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04640  Hematopoietic cell lineage
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05202  Transcriptional misregulation in cancer
hsa05221  Acute myeloid leukemia
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
nt06275  Acute myeloid leukemia
  Element
N00112  AML1-ETO fusion to PU.1-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2209 (FCGR1A)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2209 (FCGR1A)
   04666 Fc gamma R-mediated phagocytosis
    2209 (FCGR1A)
  09158 Development
   04380 Osteoclast differentiation
    2209 (FCGR1A)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2209 (FCGR1A)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    2209 (FCGR1A)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2209 (FCGR1A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2209 (FCGR1A)
   05152 Tuberculosis
    2209 (FCGR1A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2209 (FCGR1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2209 (FCGR1A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2209 (FCGR1A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2209 (FCGR1A)
CD molecules [BR:hsa04090]
 Proteins
  2209 (FCGR1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig V-set I-set Ig_4 PIRT Adeno_E3_CR1 SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 2209
NCBI-ProteinID: NP_000557
OMIM: 146760
HGNC: 3613
Ensembl: ENSG00000150337
Vega: OTTHUMG00000012089
Pharos: P12314(Tchem)
UniProt: P12314
LinkDB All DBs
Structure
PDB: 

Position
1q21.2
AA seq 374 aa AA seqDB search
MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNG
TATQTSTPSYRITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFTEGEPL
ALRCHAWKDKLVYNVLYYRNGKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAG
ISVTVKELFPAPVLNASVTSPLLEGNLVTLSCETKLLLQRPGLQLYFSFYMGSKTLRGRN
TSSEYQILTARREDSGLYWCEAATEDGNVLKRSPELELQVLGLQLPTPVWFHVLFYLAVG
IMFLVNTVLWVTIRKELKRKKKWDLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQ
LQEGVHRKEPQGAT
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcttgacaactctgctcctttgggttccagttgatgggcaagtggacaccaca
aaggcagtgatcactttgcagcctccatgggtcagcgtgttccaagaggaaaccgtaacc
ttgcactgtgaggtgctccatctgcctgggagcagctctacacagtggtttctcaatggc
acagccactcagacctcgacccccagctacagaatcacctctgccagtgtcaatgacagt
ggtgaatacaggtgccagagaggtctctcagggcgaagtgaccccatacagctggaaatc
cacagaggctggctactactgcaggtctccagcagagtcttcacggaaggagaacctctg
gccttgaggtgtcatgcgtggaaggataagctggtgtacaatgtgctttactatcgaaat
ggcaaagcctttaagtttttccactggaattctaacctcaccattctgaaaaccaacata
agtcacaatggcacctaccattgctcaggcatgggaaagcatcgctacacatcagcagga
atatctgtcactgtgaaagagctatttccagctccagtgctgaatgcatctgtgacatcc
ccactcctggaggggaatctggtcaccctgagctgtgaaacaaagttgctcttgcagagg
cctggtttgcagctttacttctccttctacatgggcagcaagaccctgcgaggcaggaac
acatcctctgaataccaaatactaactgctagaagagaagactctgggttatactggtgc
gaggctgccacagaggatggaaatgtccttaagcgcagccctgagttggagcttcaagtg
cttggcctccagttaccaactcctgtctggtttcatgtccttttctatctggcagtggga
ataatgtttttagtgaacactgttctctgggtgacaatacgtaaagaactgaaaagaaag
aaaaagtgggatttagaaatctctttggattctggtcatgagaagaaggtaatttccagc
cttcaagaagacagacatttagaagaagagctgaaatgtcaggaacaaaaagaagaacag
ctgcaggaaggggtgcaccggaaggagccccagggggccacgtag

KEGG   Homo sapiens (human): 2212Help
Entry
2212              CDS       T01001                                 

Gene name
FCGR2A, CD32, CD32A, CDw32, FCG2, FCGR2, FCGR2A1, FcGR, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIa
  KO
K06472  low affinity immunoglobulin gamma Fc receptor II-a
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04611  Platelet activation
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Disease
H00080  Systemic lupus erythematosus
H01360  Allergic rhinitis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2212 (FCGR2A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2212 (FCGR2A)
   04666 Fc gamma R-mediated phagocytosis
    2212 (FCGR2A)
  09158 Development
   04380 Osteoclast differentiation
    2212 (FCGR2A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2212 (FCGR2A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2212 (FCGR2A)
   05152 Tuberculosis
    2212 (FCGR2A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2212 (FCGR2A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2212 (FCGR2A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2212 (FCGR2A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2212 (FCGR2A)
CD molecules [BR:hsa04090]
 Proteins
  2212 (FCGR2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig I-set Ig_4 Ig_5 DUF3827 ECSCR V-set_CD47
Motif
Other DBs
NCBI-GeneID: 2212
NCBI-ProteinID: NP_001129691
OMIM: 146790
HGNC: 3616
Ensembl: ENSG00000143226
Vega: OTTHUMG00000034469
Pharos: P12318(Tbio)
UniProt: P12318
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 317 aa AA seqDB search
MTMETQMSQNVCPRNLWLLQPLTVLLLLASADSQAAAPPKAVLKLEPPWINVLQEDSVTL
TCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVL
SEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHS
HSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIIVAVVIATAVAAIVAAVVALIY
CRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQLEETNNDYETADGGYMTLNPRAPTDDD
KNIYLTLPPNDHVNSNN
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgactatggagacccaaatgtctcagaatgtatgtcccagaaacctgtggctgcttcaa
ccattgacagttttgctgctgctggcttctgcagacagtcaagctgcagctcccccaaag
gctgtgctgaaacttgagcccccgtggatcaacgtgctccaggaggactctgtgactctg
acatgccagggggctcgcagccctgagagcgactccattcagtggttccacaatgggaat
ctcattcccacccacacgcagcccagctacaggttcaaggccaacaacaatgacagcggg
gagtacacgtgccagactggccagaccagcctcagcgaccctgtgcatctgactgtgctt
tccgaatggctggtgctccagacccctcacctggagttccaggagggagaaaccatcatg
ctgaggtgccacagctggaaggacaagcctctggtcaaggtcacattcttccagaatgga
aaatcccagaaattctcccatttggatcccaccttctccatcccacaagcaaaccacagt
cacagtggtgattaccactgcacaggaaacataggctacacgctgttctcatccaagcct
gtgaccatcactgtccaagtgcccagcatgggcagctcttcaccaatggggatcattgtg
gctgtggtcattgcgactgctgtagcagccattgttgctgctgtagtggccttgatctac
tgcaggaaaaagcggatttcagccaattccactgatcctgtgaaggctgcccaatttgag
ccacctggacgtcaaatgattgccatcagaaagagacaacttgaagaaaccaacaatgac
tatgaaacagctgacggcggctacatgactctgaaccccagggcacctactgacgatgat
aaaaacatctacctgactcttcctcccaacgaccatgtcaacagtaataactaa

KEGG   Homo sapiens (human): 2213Help
Entry
2213              CDS       T01001                                 

Gene name
FCGR2B, CD32, CD32B, FCG2, FCGR2, FCGR2C, FcRII-c, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIb
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05162  Measles
Disease
H00080  Systemic lupus erythematosus
Drug target
Valziflocept: D11339
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2213 (FCGR2B)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    2213 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    2213 (FCGR2B)
  09158 Development
   04380 Osteoclast differentiation
    2213 (FCGR2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2213 (FCGR2B)
   05152 Tuberculosis
    2213 (FCGR2B)
  09172 Infectious disease: viral
   05162 Measles
    2213 (FCGR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2213 (FCGR2B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2213 (FCGR2B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2213 (FCGR2B)
CD molecules [BR:hsa04090]
 Proteins
  2213 (FCGR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set_2 DUF3827 CD34_antigen ECSCR V-set_CD47 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 2213
NCBI-ProteinID: NP_003992
OMIM: 604590
HGNC: 3618
Ensembl: ENSG00000072694
Vega: OTTHUMG00000034470
Pharos: P31994(Tbio)
UniProt: P31994
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 310 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattcagtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagctctcccaggataccctgag
tgcagggaaatgggagagaccctccctgagaaaccagccaatcccactaatcctgatgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

KEGG   Homo sapiens (human): 2214Help
Entry
2214              CDS       T01001                                 

Gene name
FCGR3A, CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20
Definition
(RefSeq) Fc fragment of IgG receptor IIIa
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Disease
H00080  Systemic lupus erythematosus
H00090  NK cell defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2214 (FCGR3A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2214 (FCGR3A)
   04666 Fc gamma R-mediated phagocytosis
    2214 (FCGR3A)
  09158 Development
   04380 Osteoclast differentiation
    2214 (FCGR3A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2214 (FCGR3A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2214 (FCGR3A)
   05152 Tuberculosis
    2214 (FCGR3A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2214 (FCGR3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2214 (FCGR3A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2214 (FCGR3A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2214 (FCGR3A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2214 (FCGR3A)
CD molecules [BR:hsa04090]
 Proteins
  2214 (FCGR3A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2214 (FCGR3A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 Izumo-Ig TadE
Motif
Other DBs
NCBI-GeneID: 2214
NCBI-ProteinID: NP_001121065
OMIM: 146740
HGNC: 3619
Ensembl: ENSG00000203747
Vega: OTTHUMG00000034466
Pharos: P08637(Tbio)
UniProt: P08637
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 254 aa AA seqDB search
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
KDHKFKWRKDPQDK
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctgctcctcccaactgctctgctacttctagtttcagctggcatgcggact
gaagatctcccaaaggctgtggtgttcctggagcctcaatggtacagggtgctcgagaag
gacagtgtgactctgaagtgccagggagcctactcccctgaggacaattccacacagtgg
tttcacaatgagagcctcatctcaagccaggcctcgagctacttcattgacgctgccaca
gtcgacgacagtggagagtacaggtgccagacaaacctctccaccctcagtgacccggtg
cagctagaagtccatatcggctggctgttgctccaggcccctcggtgggtgttcaaggag
gaagaccctattcacctgaggtgtcacagctggaagaacactgctctgcataaggtcaca
tatttacagaatggcaaaggcaggaagtattttcatcataattctgacttctacattcca
aaagccacactcaaagacagcggctcctacttctgcagggggctttttgggagtaaaaat
gtgtcttcagagactgtgaacatcaccatcactcaaggtttggcagtgtcaaccatctca
tcattctttccacctgggtaccaagtctctttctgcttggtgatggtactcctttttgca
gtggacacaggactatatttctctgtgaagacaaacattcgaagctcaacaagagactgg
aaggaccataaatttaaatggagaaaggaccctcaagacaaatga

KEGG   Homo sapiens (human): 2215Help
Entry
2215              CDS       T01001                                 

Gene name
FCGR3B, CD16, CD16A, CD16b, FCG3, FCGR3, FCGR3A, FCR-10, FCRIII, FCRIIIb
Definition
(RefSeq) Fc fragment of IgG receptor IIIb
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Disease
H00080  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2215 (FCGR3B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2215 (FCGR3B)
   04666 Fc gamma R-mediated phagocytosis
    2215 (FCGR3B)
  09158 Development
   04380 Osteoclast differentiation
    2215 (FCGR3B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2215 (FCGR3B)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2215 (FCGR3B)
   05152 Tuberculosis
    2215 (FCGR3B)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2215 (FCGR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2215 (FCGR3B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2215 (FCGR3B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2215 (FCGR3B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2215 (FCGR3B)
CD molecules [BR:hsa04090]
 Proteins
  2215 (FCGR3B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2215 (FCGR3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set
Motif
Other DBs
NCBI-GeneID: 2215
NCBI-ProteinID: NP_000561
OMIM: 610665
HGNC: 3620
Ensembl: ENSG00000162747
Vega: OTTHUMG00000074099
Pharos: O75015(Tbio)
UniProt: O75015 A0A3B3ISU3
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 233 aa AA seqDB search
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQW
FHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKN
VSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgtggcagctgctcctcccaactgctctgctacttctagtttcagctggcatgcggact
gaagatctcccaaaggctgtggtgttcctggagcctcaatggtacagcgtgcttgagaag
gacagtgtgactctgaagtgccagggagcctactcccctgaggacaattccacacagtgg
tttcacaatgagaacctcatctcaagccaggcctcgagctacttcattgacgctgccaca
gtcaacgacagtggagagtacaggtgccagacaaacctctccaccctcagtgacccggtg
cagctagaagtccatatcggctggctgttgctccaggcccctcggtgggtgttcaaggag
gaagaccctattcacctgaggtgtcacagctggaagaacactgctctgcataaggtcaca
tatttacagaatggcaaagacaggaagtattttcatcataattctgacttccacattcca
aaagccacactcaaagatagcggctcctacttctgcagggggcttgttgggagtaaaaat
gtgtcttcagagactgtgaacatcaccatcactcaaggtttggcagtgtcaaccatctca
tcattctctccacctgggtaccaagtctctttctgcttggtgatggtactcctttttgca
gtggacacaggactatatttctctgtgaagacaaacatttga

KEGG   Homo sapiens (human): 9103Help
Entry
9103              CDS       T01001                                 

Gene name
FCGR2C, CD32, CD32C, CDW32, FCG2, FCRIIC, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIc (gene/pseudogene)
  KO
K16824  low affinity immunoglobulin gamma Fc receptor II-c
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
Disease
H01240  Immune thrombocytopenia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    9103 (FCGR2C)
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    9103 (FCGR2C)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    9103 (FCGR2C)
   05152 Tuberculosis
    9103 (FCGR2C)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    9103 (FCGR2C)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    9103 (FCGR2C)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    9103 (FCGR2C)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    9103 (FCGR2C)
CD molecules [BR:hsa04090]
 Proteins
  9103 (FCGR2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 DUF3827 C2-set_2 Protocadherin CD34_antigen Adeno_E3_CR2 V-set_CD47 ECSCR
Motif
Other DBs
NCBI-GeneID: 9103
NCBI-ProteinID: NP_963857
OMIM: 612169
HGNC: 15626
Pharos: P31995(Tbio)
UniProt: P31995
LinkDB All DBs
Position
1q23.3
AA seq 323 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIPWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISANSTDPVKAAQFEPPGRQMIAIRKRQPEETNNDYETADGGYMTLNPR
APTDDDKNIYLTLPPNDHVNSNN
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaagaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattccgtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagccaattccactgatcctgtg
aaggctgcccaatttgagccacctggacgtcaaatgattgccatcagaaagagacaacct
gaagaaaccaacaatgactatgaaacagctgacggcggctacatgactctgaaccccagg
gcacctactgacgatgataaaaacatctacctgactcttcctcccaacgaccatgtcaac
agtaataactaa

DBGET integrated database retrieval system