KEGG   Homo sapiens (human): 2213Help
Entry
2213              CDS       T01001                                 

Gene name
FCGR2B, CD32, CD32B, FCG2, FCGR2, FCGR2C, FcRII-c, IGFR2
Definition
(RefSeq) Fc fragment of IgG receptor IIb
  KO
K12560  low affinity immunoglobulin gamma Fc receptor II-b
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04662  B cell receptor signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05162  Measles
Disease
H00080  Systemic lupus erythematosus
Drug target
Valziflocept: D11339
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2213 (FCGR2B)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    2213 (FCGR2B)
   04666 Fc gamma R-mediated phagocytosis
    2213 (FCGR2B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    2213 (FCGR2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2213 (FCGR2B)
   05152 Tuberculosis
    2213 (FCGR2B)
  09172 Infectious disease: viral
   05162 Measles
    2213 (FCGR2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2213 (FCGR2B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2213 (FCGR2B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2213 (FCGR2B)
CD molecules [BR:hsa04090]
 Proteins
  2213 (FCGR2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set_2 DUF3827 CD34_antigen ECSCR V-set_CD47 Adeno_E3_CR2
Motif
Other DBs
NCBI-GeneID: 2213
NCBI-ProteinID: NP_003992
OMIM: 604590
HGNC: 3618
Ensembl: ENSG00000072694
Vega: OTTHUMG00000034470
Pharos: P31994(Tbio)
UniProt: P31994
LinkDB All DBs
Structure
PDB: 

Position
1q23.3
AA seq 310 aa AA seqDB search
MGILSFLPVLATESDWADCKSPQPWGHMLLWTAVLFLAPVAGTPAAPPKAVLKLEPQWIN
VLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSL
SDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPN
FSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAPSSSPMGIIVAVVTGIAVAAIVAA
VVALIYCRKKRISALPGYPECREMGETLPEKPANPTNPDEADKVGAENTITYSLLMHPDA
LEEPDDQNRI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggaatcctgtcattcttacctgtccttgccactgagagtgactgggctgactgcaag
tccccccagccttggggtcatatgcttctgtggacagctgtgctattcctggctcctgtt
gctgggacacctgcagctcccccaaaggctgtgctgaaactcgagccccagtggatcaac
gtgctccaggaggactctgtgactctgacatgccgggggactcacagccctgagagcgac
tccattcagtggttccacaatgggaatctcattcccacccacacgcagcccagctacagg
ttcaaggccaacaacaatgacagcggggagtacacgtgccagactggccagaccagcctc
agcgaccctgtgcatctgactgtgctttctgagtggctggtgctccagacccctcacctg
gagttccaggagggagaaaccatcgtgctgaggtgccacagctggaaggacaagcctctg
gtcaaggtcacattcttccagaatggaaaatccaagaaattttcccgttcggatcccaac
ttctccatcccacaagcaaaccacagtcacagtggtgattaccactgcacaggaaacata
ggctacacgctgtactcatccaagcctgtgaccatcactgtccaagctcccagctcttca
ccgatggggatcattgtggctgtggtcactgggattgctgtagcggccattgttgctgct
gtagtggccttgatctactgcaggaaaaagcggatttcagctctcccaggataccctgag
tgcagggaaatgggagagaccctccctgagaaaccagccaatcccactaatcctgatgag
gctgacaaagttggggctgagaacacaatcacctattcacttctcatgcacccggatgct
ctggaagagcctgatgaccagaaccgtatttag

DBGET integrated database retrieval system