KEGG   Homo sapiens (human): 2214
Entry
2214              CDS       T01001                                 

Gene name
FCGR3A, CD16, CD16A, FCG3, FCGR3, FCGRIII, FCR-10, FCRIII, FCRIIIA, IGFR3, IMD20
Definition
(RefSeq) Fc fragment of IgG receptor IIIa
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01090  IGG-FCGR-RAC signaling pathway
N01091  Escherichia EspJ to IGG-FCGR-RAC signaling pathway
Disease
H00080  Systemic lupus erythematosus
H00090  NK cell defects
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2214 (FCGR3A)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2214 (FCGR3A)
   04666 Fc gamma R-mediated phagocytosis
    2214 (FCGR3A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    2214 (FCGR3A)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2214 (FCGR3A)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2214 (FCGR3A)
   05152 Tuberculosis
    2214 (FCGR3A)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2214 (FCGR3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2214 (FCGR3A)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2214 (FCGR3A)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2214 (FCGR3A)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2214 (FCGR3A)
CD molecules [BR:hsa04090]
 Proteins
  2214 (FCGR3A)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2214 (FCGR3A)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5
Other DBs
NCBI-GeneID: 2214
NCBI-ProteinID: NP_000560
OMIM: 146740
HGNC: 3619
Ensembl: ENSG00000203747
Vega: OTTHUMG00000034466
Pharos: P08637(Tbio)
UniProt: P08637 M9MML0
LinkDB
Structure
PDB: 

Position
1q23.3
AA seq 254 aa
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQW
FHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLFGSKN
VSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFSVKTNIRSSTRDW
KDHKFKWRKDPQDK
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtggcagctgctcctcccaactgctctgctacttctagtttcagctggcatgcggact
gaagatctcccaaaggctgtggtgttcctggagcctcaatggtacagggtgctcgagaag
gacagtgtgactctgaagtgccagggagcctactcccctgaggacaattccacacagtgg
tttcacaatgagagcctcatctcaagccaggcctcgagctacttcattgacgctgccaca
gtcgacgacagtggagagtacaggtgccagacaaacctctccaccctcagtgacccggtg
cagctagaagtccatatcggctggctgttgctccaggcccctcggtgggtgttcaaggag
gaagaccctattcacctgaggtgtcacagctggaagaacactgctctgcataaggtcaca
tatttacagaatggcaaaggcaggaagtattttcatcataattctgacttctacattcca
aaagccacactcaaagacagcggctcctacttctgcagggggctttttgggagtaaaaat
gtgtcttcagagactgtgaacatcaccatcactcaaggtttggcagtgtcaaccatctca
tcattctttccacctgggtaccaagtctctttctgcttggtgatggtactcctttttgca
gtggacacaggactatatttctctgtgaagacaaacattcgaagctcaacaagagactgg
aaggaccataaatttaaatggagaaaggaccctcaagacaaatga

KEGG   Homo sapiens (human): 2215
Entry
2215              CDS       T01001                                 

Gene name
FCGR3B, CD16, CD16A, CD16b, FCG3, FCGR3, FCGR3A, FCR-10, FCRIII, FCRIIIb
Definition
(RefSeq) Fc fragment of IgG receptor IIIb
  KO
K06463  low affinity immunoglobulin gamma Fc receptor III
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04666  Fc gamma R-mediated phagocytosis
hsa05140  Leishmaniasis
hsa05150  Staphylococcus aureus infection
hsa05152  Tuberculosis
hsa05322  Systemic lupus erythematosus
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01090  IGG-FCGR-RAC signaling pathway
N01091  Escherichia EspJ to IGG-FCGR-RAC signaling pathway
Disease
H00080  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    2215 (FCGR3B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    2215 (FCGR3B)
   04666 Fc gamma R-mediated phagocytosis
    2215 (FCGR3B)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    2215 (FCGR3B)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    2215 (FCGR3B)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    2215 (FCGR3B)
   05152 Tuberculosis
    2215 (FCGR3B)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    2215 (FCGR3B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2215 (FCGR3B)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    2215 (FCGR3B)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    2215 (FCGR3B)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    2215 (FCGR3B)
CD molecules [BR:hsa04090]
 Proteins
  2215 (FCGR3B)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Receptors
  2215 (FCGR3B)
SSDB
Motif
Pfam: Ig_2 Ig_3 ig Ig_4 I-set V-set Ig_5 C2-set
Other DBs
NCBI-GeneID: 2215
NCBI-ProteinID: NP_000561
OMIM: 610665
HGNC: 3620
Ensembl: ENSG00000162747
Vega: OTTHUMG00000074099
Pharos: O75015(Tbio)
UniProt: O75015 A0A3B3ISU3
LinkDB
Structure
PDB: 

Position
1q23.3
AA seq 233 aa
MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQW
FHNENLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKE
EDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKN
VSSETVNITITQGLAVSTISSFSPPGYQVSFCLVMVLLFAVDTGLYFSVKTNI
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtggcagctgctcctcccaactgctctgctacttctagtttcagctggcatgcggact
gaagatctcccaaaggctgtggtgttcctggagcctcaatggtacagcgtgcttgagaag
gacagtgtgactctgaagtgccagggagcctactcccctgaggacaattccacacagtgg
tttcacaatgagaacctcatctcaagccaggcctcgagctacttcattgacgctgccaca
gtcaacgacagtggagagtacaggtgccagacaaacctctccaccctcagtgacccggtg
cagctagaagtccatatcggctggctgttgctccaggcccctcggtgggtgttcaaggag
gaagaccctattcacctgaggtgtcacagctggaagaacactgctctgcataaggtcaca
tatttacagaatggcaaagacaggaagtattttcatcataattctgacttccacattcca
aaagccacactcaaagatagcggctcctacttctgcagggggcttgttgggagtaaaaat
gtgtcttcagagactgtgaacatcaccatcactcaaggtttggcagtgtcaaccatctca
tcattctctccacctgggtaccaagtctctttctgcttggtgatggtactcctttttgca
gtggacacaggactatatttctctgtgaagacaaacatttga

DBGET integrated database retrieval system