KEGG   Homo sapiens (human): 221613
Entry
221613            CDS       T01001                                 

Gene name
H2AC1, H2AA, H2AFR, HIST1H2AA, TH2A, bA317E16.2
Definition
(RefSeq) H2A clustered histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    221613 (H2AC1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    221613 (H2AC1)
  09165 Substance dependence
   05034 Alcoholism
    221613 (H2AC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    221613 (H2AC1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    221613 (H2AC1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    221613 (H2AC1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   221613 (H2AC1)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 221613
NCBI-ProteinID: NP_734466
OMIM: 613499
HGNC: 18729
Ensembl: ENSG00000164508
Vega: OTTHUMG00000014407
Pharos: Q96QV6(Tdark)
UniProt: Q96QV6
LinkDB
Structure
PDB: 
5GT0 5GSU

Position
6p22.2
AA seq 131 aa
MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
NT seq 396 nt   +upstreamnt  +downstreamnt
atgtctggacgagggaagcagggaggaaaagcacgcgccaagtctaagtctcgctcttct
agagcgggtttgcagtttcccgtaggccggatccatcgtctgcttcgtaagggaaactat
gcagagcggataggggcaggcgcaccagtgtatttggcggcagtgttagagtatctcaca
gcagaaatccttgagctggcaggcaatgcgtctcgcgataacaaaaaaactcgcattatt
ccccgccacctgcagctagcgatccgcaatgatgaggaactcaataagcttttgggcggc
gtgaccattgcccagggcggagtcctgcctaacattcaggcagtgctgctgcccaagaag
actgagagtcaccaccataaagcccaaagcaagtaa

KEGG   Homo sapiens (human): 3012
Entry
3012              CDS       T01001                                 

Gene name
H2AC8, H2A.1, H2A.2, H2A/a, H2AC4, H2AFA, HIST1H2AE
Definition
(RefSeq) H2A clustered histone 8
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3012 (H2AC8)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3012 (H2AC8)
  09165 Substance dependence
   05034 Alcoholism
    3012 (H2AC8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3012 (H2AC8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3012 (H2AC8)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3012 (H2AC8)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3012 (H2AC8)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 3012
NCBI-ProteinID: NP_066390
OMIM: 602786
HGNC: 4724
Ensembl: ENSG00000277075
Vega: OTTHUMG00000014440
UniProt: P04908 Q08AJ9
LinkDB
Structure
PDB: 

Position
6p22.2
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtggaaagcaaggcggcaaagctcgggcaaaagctaaaacgcgttcttcc
agggccggtcttcagtttccagttggccgtgtgcaccgcctcctccgcaaaggcaactac
tccgaacgagtcggggccggcgctccagtgtacctggcagcggtgctggaatatctgacg
gccgagatcttagagctagctggcaacgcggctcgcgacaataagaagacccgcatcatc
ccgcgccacctgcagctagccatccgcaacgacgaggagctaaataagcttctaggtcgc
gtgaccatcgcgcagggcggtgtcctgcccaacatccaggccgtattgctgcctaagaag
acggagagccaccataaggccaagggcaagtga

KEGG   Homo sapiens (human): 3013
Entry
3013              CDS       T01001                                 

Gene name
H2AC7, H2A.3, H2A/g, H2AFG, HIST1H2AD
Definition
(RefSeq) H2A clustered histone 7
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3013 (H2AC7)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3013 (H2AC7)
  09165 Substance dependence
   05034 Alcoholism
    3013 (H2AC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3013 (H2AC7)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3013 (H2AC7)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3013 (H2AC7)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3013 (H2AC7)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 3013
NCBI-ProteinID: NP_066409
OMIM: 602792
HGNC: 4729
Ensembl: ENSG00000196866
Vega: OTTHUMG00000014437
Pharos: P20671(Tdark)
UniProt: P20671 B2R5B6
LinkDB
Structure
PDB: 
5GT3

Position
6p22.2
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggacgcggcaagcaaggcggaaaggcccgagctaaggctaagacccgctcttcg
cgggccggactccagttccctgtgggccgcgtacaccgcttgctccgcaagggcaactac
tccgagcgagtcggggccggcgcgccagtgtatctggcggcggtgttggagtacctgacc
gccgagatcctggagctggcgggcaacgccgcccgcgacaacaagaagacccgcatcatc
ccccgacacctgcagctggccatccgcaacgacgaggagctaaacaagttgctgggtaaa
gtcacaattgctcagggcggtgttctgcccaacatccaggctgtactgctccccaagaag
actgagagtcaccacaaggccaagggcaagtaa

KEGG   Homo sapiens (human): 3014
Entry
3014              CDS       T01001                                 

Gene name
H2AX, H2A.X, H2A/X, H2AFX
Definition
(RefSeq) H2A.X variant histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3014 (H2AX)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3014 (H2AX)
  09165 Substance dependence
   05034 Alcoholism
    3014 (H2AX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3014 (H2AX)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3014 (H2AX)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3014 (H2AX)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3014 (H2AX)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3014
NCBI-ProteinID: NP_002096
OMIM: 601772
HGNC: 4739
Ensembl: ENSG00000188486
Vega: OTTHUMG00000166196
Pharos: P16104(Tbio)
UniProt: P16104
LinkDB
Position
11q23.3
AA seq 143 aa
MSGRGKTGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGHYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TSATVGPKAPSGGKKATQASQEY
NT seq 432 nt   +upstreamnt  +downstreamnt
atgtcgggccgcggcaagactggcggcaaggcccgcgccaaggccaagtcgcgctcgtcg
cgcgccggcctccagttcccagtgggccgtgtacaccggctgctgcggaagggccactac
gccgagcgcgttggcgccggcgcgccagtgtacctggcggcagtgctggagtacctcacc
gctgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacgcgaatcatc
ccccgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcggc
gtgacgatcgcccagggaggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
accagcgccaccgtggggccgaaggcgccctcgggcggcaagaaggccacccaggcctcc
caggagtactaa

KEGG   Homo sapiens (human): 3015
Entry
3015              CDS       T01001                                 

Gene name
H2AZ1, H2A.Z-1, H2A.z, H2A/z, H2AFZ, H2AZ
Definition
(RefSeq) H2A.Z variant histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    3015 (H2AZ1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    3015 (H2AZ1)
  09165 Substance dependence
   05034 Alcoholism
    3015 (H2AZ1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3015 (H2AZ1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    3015 (H2AZ1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    3015 (H2AZ1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   3015 (H2AZ1)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 3015
NCBI-ProteinID: NP_002097
OMIM: 142763
HGNC: 4741
Ensembl: ENSG00000164032
Vega: OTTHUMG00000131048
Pharos: P0C0S5(Tbio)
UniProt: P0C0S5
LinkDB
Structure
PDB: 

Position
4q23
AA seq 128 aa
MAGGKAGKDSGKAKTKAVSRSQRAGLQFPVGRIHRHLKSRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTV
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggcggtaaggctggaaaggactccggaaaggccaagacaaaggcggtttcccgc
tcgcagagagccggcttgcagttcccagtgggccgtattcatcgacacctaaaatctagg
acgaccagtcatggacgtgtgggcgcgactgccgctgtgtacagcgcagccatcctggag
tacctcaccgcagaggtacttgaactggcaggaaatgcatcaaaagacttaaaggtaaag
cgtattacccctcgtcacttgcaacttgctattcgtggagatgaagaattggattctctc
atcaaggctacaattgctggtggtggtgtcattccacacatccacaaatctctgattggg
aagaaaggacaacagaagactgtctaa

KEGG   Homo sapiens (human): 317772
Entry
317772            CDS       T01001                                 

Gene name
H2AC21, H2AB, HIST2H2AB
Definition
(RefSeq) H2A clustered histone 21
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    317772 (H2AC21)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    317772 (H2AC21)
  09165 Substance dependence
   05034 Alcoholism
    317772 (H2AC21)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    317772 (H2AC21)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    317772 (H2AC21)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    317772 (H2AC21)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   317772 (H2AC21)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 317772
NCBI-ProteinID: NP_778235
OMIM: 615014
HGNC: 20508
Ensembl: ENSG00000184270
Vega: OTTHUMG00000012085
Pharos: Q8IUE6(Tdark)
UniProt: Q8IUE6
LinkDB
Position
1q21.2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHKPGKNK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcaggacgcggaaagcagggaggcaaggcccgcgctaaggccaagtcgcgctcgtcc
cgcgctggtctccagttcccggtggggcgagtgcaccgcttgctgcgcaaaggcaactac
gcggagcgggtcggggcaggcgccccggtgtacctggcggcggtcctcgagtacctgacc
gcggaaattctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgccatctgcaactagccgtgaggaatgacgaagagctcaacaagttactcgggggt
gtcaccattgcccagggcggcgtcttgcccaatatccaggctgtcctgttgcccaagaaa
acggagagtcacaagcctggcaagaacaagtaa

KEGG   Homo sapiens (human): 474381
Entry
474381            CDS       T01001                                 

Gene name
H2AB2, H2A.Bbd, H2AB3, H2AFB2
Definition
(RefSeq) H2A.B variant histone 2
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    474381 (H2AB2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    474381 (H2AB2)
  09165 Substance dependence
   05034 Alcoholism
    474381 (H2AB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    474381 (H2AB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    474381 (H2AB2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    474381 (H2AB2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474381 (H2AB2)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 474381
NCBI-ProteinID: NP_001017991
OMIM: 301038
HGNC: 18298
Ensembl: ENSG00000277858
Vega: OTTHUMG00000034292
UniProt: P0C5Z0
LinkDB
Position
Xq28
AA seq 115 aa
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

KEGG   Homo sapiens (human): 474382
Entry
474382            CDS       T01001                                 

Gene name
H2AB1, H2A.B, H2A.Bbd, H2AFB1
Definition
(RefSeq) H2A.B variant histone 1
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    474382 (H2AB1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    474382 (H2AB1)
  09165 Substance dependence
   05034 Alcoholism
    474382 (H2AB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    474382 (H2AB1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    474382 (H2AB1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    474382 (H2AB1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   474382 (H2AB1)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 474382
NCBI-ProteinID: NP_001017990
OMIM: 301037
HGNC: 22516
Ensembl: ENSG00000274183
Vega: OTTHUMG00000034291
Pharos: P0C5Y9(Tdark)
UniProt: P0C5Y9
LinkDB
Position
Xq28
AA seq 115 aa
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVPELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcccggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

KEGG   Homo sapiens (human): 55506
Entry
55506             CDS       T01001                                 

Gene name
MACROH2A2, H2AFY2
Definition
(RefSeq) macroH2A.2 histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55506 (MACROH2A2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    55506 (MACROH2A2)
  09165 Substance dependence
   05034 Alcoholism
    55506 (MACROH2A2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55506 (MACROH2A2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55506 (MACROH2A2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    55506 (MACROH2A2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55506 (MACROH2A2)
SSDB
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Other DBs
NCBI-GeneID: 55506
NCBI-ProteinID: NP_061119
OMIM: 616141
HGNC: 14453
Ensembl: ENSG00000099284
Vega: OTTHUMG00000018396
Pharos: Q9P0M6(Tbio)
UniProt: Q9P0M6 A0A024QZP6
LinkDB
Structure
PDB: 
6FY5 2XD7

Position
10q22.1
AA seq 372 aa
MSGRSGKKKMSKLSRSARAGVIFPVGRLMRYLKKGTFKYRISVGAPVYMAAVIEYLAAEI
LELAGNAARDNKKARIAPRHILLAVANDEELNQLLKGVTIASGGVLPRIHPELLAKKRGT
KGKSETILSPPPEKRGRKATSGKKGGKKSKAAKPRTSKKSKPKDSDKEGTSNSTSEDGPG
DGFTILSSKSLVLGQKLSLTQSDISHIGSMRVEGIVHPTTAEIDLKEDIGKALEKAGGKE
FLETVKELRKSQGPLEVAEAAVSQSSGLAAKFVIHCHIPQWGSDKCEEQLEETIKNCLSA
AEDKKLKSVAFPPFPSGRNCFPKQTAAQVTLKAISAHFDDSSASSLKNVYFLLFDSESIG
IYVQEMAKLDAK
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcgggccggagtgggaagaagaaaatgtccaagctgtcccgttcagctagggcaggt
gtcatctttccagtggggaggctgatgcgttatctgaagaaagggacgttcaagtaccgg
atcagcgtgggcgcccctgtctacatggcggcagtcattgagtacctggcagcggaaatt
ctagaattggccggcaatgccgcgagggacaacaagaaggcccggatagccccgagacac
atcttgctggcagttgccaatgacgaggagctcaaccagctgctaaaaggagtgaccatc
gccagtggaggcgtcctgcccagaattcaccccgaactgctggccaaaaagcgagggacc
aaaggcaagtcggaaacgatcctctccccacccccagagaaaagaggcaggaaggccacg
tcaggcaagaagggggggaagaaatccaaggctgccaaaccacggacgtccaaaaagtcc
aaaccaaaggacagcgataaagaaggaacttcaaattccacctctgaagatgggccaggg
gatggattcaccattctgtcttctaagagccttgttctgggacagaagctgtccttaacc
cagagtgacatcagccatattggctccatgagagtggagggcattgtccacccaaccaca
gccgaaattgacctcaaagaagatataggtaaagccttggaaaaggctgggggaaaagag
ttcttggaaacggtaaaggagcttcgcaaatcccaaggccctttggaagtcgccgaagcc
gccgtcagccaatccagtggactcgcagccaaatttgtcatccactgtcacatccctcag
tggggctccgacaaatgtgaagaacagcttgaagagaccatcaaaaactgcctgtcagcg
gcggaggacaagaagctaaagtccgtcgcgttcccgcctttccccagcggcagaaactgc
tttcccaaacagactgcggcccaggtgaccctcaaagccatctcagcccactttgatgac
tcgagcgcgtcctcgctgaagaacgtgtacttcctgctcttcgacagcgagagcatcggc
atctacgtgcaggagatggccaagctcgacgccaagtag

KEGG   Homo sapiens (human): 55766
Entry
55766             CDS       T01001                                 

Gene name
H2AJ, H2AFJ
Definition
(RefSeq) H2A.J histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    55766 (H2AJ)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    55766 (H2AJ)
  09165 Substance dependence
   05034 Alcoholism
    55766 (H2AJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    55766 (H2AJ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    55766 (H2AJ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    55766 (H2AJ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   55766 (H2AJ)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 55766
NCBI-ProteinID: NP_808760
HGNC: 14456
Ensembl: ENSG00000246705
Vega: OTTHUMG00000168736
Pharos: Q9BTM1(Tbio)
UniProt: Q9BTM1 A0A024RAS2
LinkDB
Position
12p12.3
AA seq 129 aa
MSGRGKQGGKVRAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESQKTKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtccggtcgcgggaaacagggcggcaaagtgcgagcaaaggccaaatcccgctcctcc
cgcgcgggcctgcagttcccggtgggccgagtgcacagactgctgcgcaaagggaactac
gcggagcgagtgggcgccggggcgccggtgtacctggcggcggtgttggagtaccttacg
gcggagatcctggagctggctggcaacgccgcgcgtgacaacaagaagaccaggataatt
ccccgccacctgcagctcgccatccgcaacgacgaggagttaaacaagctgctgggcaaa
gtgaccatcgctcagggcggcgtcctgcccaacatccaggccgtgctgctgcccaagaag
acggagagtcagaagacgaagagcaaatga

KEGG   Homo sapiens (human): 723790
Entry
723790            CDS       T01001                                 

Gene name
H2AC19, H2A/R, H2AC18, HIST2H2AA4
Definition
(RefSeq) H2A clustered histone 19
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    723790 (H2AC19)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    723790 (H2AC19)
  09165 Substance dependence
   05034 Alcoholism
    723790 (H2AC19)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    723790 (H2AC19)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    723790 (H2AC19)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    723790 (H2AC19)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   723790 (H2AC19)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 723790
NCBI-ProteinID: NP_001035807
HGNC: 29668
Ensembl: ENSG00000272196
Vega: OTTHUMG00000012097
UniProt: Q6FI13
LinkDB
Structure
PDB: 

Position
1q21.2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggtcgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc
cgcgctggccttcagttcccggtagggcgagtgcatcgcttgctgcgcaaaggcaactac
gcggagcgagtgggggccggcgcgcccgtctacatggctgcggtcctcgagtatctgacc
gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggcaaa
gtcaccatcgcccagggcggcgtcttgcctaacatccaggccgtactgctccctaagaag
acggagagtcaccacaaggcaaagggcaagtga

KEGG   Homo sapiens (human): 8329
Entry
8329              CDS       T01001                                 

Gene name
H2AC13, H2A/c, H2AC11, H2AC15, H2AC16, H2AC17, H2AFC, HIST1H2AI
Definition
(RefSeq) H2A clustered histone 13
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8329 (H2AC13)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8329 (H2AC13)
  09165 Substance dependence
   05034 Alcoholism
    8329 (H2AC13)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8329 (H2AC13)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8329 (H2AC13)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8329 (H2AC13)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8329 (H2AC13)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8329
NCBI-ProteinID: NP_003500
OMIM: 602787
HGNC: 4725
Ensembl: ENSG00000196747
Vega: OTTHUMG00000014484
UniProt: P0C0S8 A4FTV9
LinkDB
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctgggcgtggcaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct
cgggccgggcttcagtttcccgtaggccgagtgcatcgcctgctccgcaaaggcaactat
gcggagcgggtcggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacc
gccgagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatc
ccgcgtcacctccagctggccatccgcaacgatgaggagctcaacaagcttctgggcaaa
gtcaccatcgcacagggtggcgtcctgcccaacatccaggccgtgctactgcccaagaag
accgagagccaccacaaggcgaagggcaagtag

KEGG   Homo sapiens (human): 8330
Entry
8330              CDS       T01001                                 

Gene name
H2AC15, H2A.1, H2A/d, H2AC11, H2AC13, H2AC14, H2AC16, H2AC17, H2AFD, HIST1H2AK
Definition
(RefSeq) H2A clustered histone 15
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8330 (H2AC15)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8330 (H2AC15)
  09165 Substance dependence
   05034 Alcoholism
    8330 (H2AC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8330 (H2AC15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8330 (H2AC15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8330 (H2AC15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8330 (H2AC15)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8330
NCBI-ProteinID: NP_003501
OMIM: 602788
HGNC: 4726
Ensembl: ENSG00000275221
Vega: OTTHUMG00000016382
UniProt: P0C0S8 A4FTV9
LinkDB
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcgggacgtggcaagcagggcggcaaagctcgcgccaaggctaagacccgttcttca
agggcgggtcttcagttcccagtgggccgagtgcaccgactgctccgcaagggcaactac
gctgagcgggtcggtgccggagcgccggtgtacctggcggcggtgttggagtacctaacc
gccgagatcctggaactggctggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgcttggtaaa
gtgaccatcgcccagggtggtgtcctgcccaatatccaggccgtgctgctgcctaagaaa
actgagagccaccacaaggccaagggcaagtag

KEGG   Homo sapiens (human): 8331
Entry
8331              CDS       T01001                                 

Gene name
H2AC14, H2A/E, H2AFE, HIST1H2AJ, dJ160A22.4
Definition
(RefSeq) H2A clustered histone 14
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8331 (H2AC14)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8331 (H2AC14)
  09165 Substance dependence
   05034 Alcoholism
    8331 (H2AC14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8331 (H2AC14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8331 (H2AC14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8331 (H2AC14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8331 (H2AC14)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8331
NCBI-ProteinID: NP_066544
OMIM: 602791
HGNC: 4727
Ensembl: ENSG00000276368
Vega: OTTHUMG00000014486
Pharos: Q99878(Tdark)
UniProt: Q99878
LinkDB
Position
6p22.1
AA seq 128 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKTK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct
cgggccgggcttcagtttcccgtaggccgagtgcatcgcctgctccgcaaaggcaactat
gcggagcgggtcggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacc
gccgagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatc
ccgcgtcacctccagctggccatccgcaacgatgaggagctcaacaagcttctgggcaaa
gtcaccatcgcacagggtggcgtcctgcccaacatccaggccgtgctgctgccaaagaaa
actgagagccaccacaagactaagtaa

KEGG   Homo sapiens (human): 8332
Entry
8332              CDS       T01001                                 

Gene name
H2AC16, H2A.i, H2A/i, H2AC11, H2AC13, H2AC15, H2AC17, H2AFI, HIST1H2AL, dJ193B12.9
Definition
(RefSeq) H2A clustered histone 16
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8332 (H2AC16)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8332 (H2AC16)
  09165 Substance dependence
   05034 Alcoholism
    8332 (H2AC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8332 (H2AC16)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8332 (H2AC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8332 (H2AC16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8332 (H2AC16)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8332
NCBI-ProteinID: NP_003502
OMIM: 602793
HGNC: 4730
Ensembl: ENSG00000276903
Vega: OTTHUMG00000014492
UniProt: P0C0S8 A4FTV9
LinkDB
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcgggacgcggcaagcagggaggcaaagctcgcgccaaagccaagacccgctcttct
cgtgccggtctccagttccccgtgggccgagtgcaccgactgctccgcaagggcaactat
gctgagcgggtcggggccggcgcgccggtgtacctggcggcggtgctggagtacctgact
gccgagatcctggagctggcgggcaacgccgcccgcgacaacaagaagacccgcattatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtaaccatcgctcagggtggtgtcctgcccaacatccaggctgtgctactgcccaagaag
accgagagtcaccacaaggccaaaggcaaataa

KEGG   Homo sapiens (human): 8334
Entry
8334              CDS       T01001                                 

Gene name
H2AC6, H2A/l, H2AFL, HIST1H2AC, dJ221C16.4
Definition
(RefSeq) H2A clustered histone 6
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8334 (H2AC6)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8334 (H2AC6)
  09165 Substance dependence
   05034 Alcoholism
    8334 (H2AC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8334 (H2AC6)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8334 (H2AC6)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8334 (H2AC6)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8334 (H2AC6)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 8334
NCBI-ProteinID: NP_003503
OMIM: 602794
HGNC: 4733
Ensembl: ENSG00000180573
Vega: OTTHUMG00000014428
Pharos: Q93077(Tdark)
UniProt: Q93077 A0A024R017
LinkDB
Structure
PDB: 
6MUP 6MUO 6C0W 5KGF

Position
6p22.2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtggtaagcaaggaggcaaagctcgcgccaaagcgaaatcccgctcttct
cgcgctggtctccagttcccggtgggccgagtgcaccgcctgctccgtaaaggcaactac
gcagagcgggttggggcaggcgcgccggtgtacctggcggcggtgttagagtacctgacc
gccgagatcctggagctggccggcaacgcggctcgcgacaacaagaagactcgcatcatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaaactgctaggccgg
gtgaccattgctcagggcggcgtccttcctaacatccaggccgtgcttctgcctaagaag
accgagagtcaccacaaggccaagggcaagtga

KEGG   Homo sapiens (human): 8335
Entry
8335              CDS       T01001                                 

Gene name
H2AC4, H2A/m, H2AC8, H2AFM, HIST1H2AB
Definition
(RefSeq) H2A clustered histone 4
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8335 (H2AC4)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8335 (H2AC4)
  09165 Substance dependence
   05034 Alcoholism
    8335 (H2AC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8335 (H2AC4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8335 (H2AC4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8335 (H2AC4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8335 (H2AC4)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8335
NCBI-ProteinID: NP_003504
OMIM: 602795
HGNC: 4734
Ensembl: ENSG00000278463
Vega: OTTHUMG00000014420
Pharos: P04908(Tdark)
UniProt: P04908 Q08AJ9
LinkDB
Structure
PDB: 

Position
6p22.2
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggtcgcggcaaacaaggcggtaaagctcgcgccaaggctaagactcggtcttct
cgtgcaggtttgcagtttcctgtgggccgagtgcaccgcctgctccgcaaaggcaactac
tccgagcgcgtcggggctggcgcgccggtgtatctcgcggcggtgcttgagtacctgacc
gccgagatcctggagctggcgggcaatgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacctgcaattggccatccgcaatgacgaggagcttaataaactcttggggcgt
gtgaccatcgcgcagggtggcgttttgcctaatattcaggcggtgctgctgcctaagaaa
actgagagccatcataaggccaagggaaagtga

KEGG   Homo sapiens (human): 8336
Entry
8336              CDS       T01001                                 

Gene name
H2AC17, H2A.1, H2A/n, H2AC11, H2AC13, H2AC15, H2AC16, H2AFN, HIST1H2AM, dJ193B12.1
Definition
(RefSeq) H2A clustered histone 17
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8336 (H2AC17)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8336 (H2AC17)
  09165 Substance dependence
   05034 Alcoholism
    8336 (H2AC17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8336 (H2AC17)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8336 (H2AC17)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8336 (H2AC17)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8336 (H2AC17)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8336
NCBI-ProteinID: NP_003505
OMIM: 602796
HGNC: 4735
Ensembl: ENSG00000278677
Vega: OTTHUMG00000014494
UniProt: P0C0S8 A4FTV9
LinkDB
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtggcaagcagggcggcaaggctcgcgccaaggccaaaacccgctcctct
agagctgggctccaatttcctgtaggacgagtgcaccgcctgctccgcaagggcaactac
gctgagcgggtcggggccggcgcgccggtttacctggcggcggtgctggagtacctaact
gccgagatcctggagctggcgggcaacgcagcccgcgacaacaaaaagacccgcatcatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgcttggtaaa
gttaccatcgctcagggcggtgttctgcctaacatccaggccgtactgctccccaagaag
actgagagccaccacaaagctaagggcaagtaa

KEGG   Homo sapiens (human): 8337
Entry
8337              CDS       T01001                                 

Gene name
H2AC18, H2A, H2A.2, H2A/O, H2A/q, H2AC19, H2AFO, H2a-615, HIST2H2AA, HIST2H2AA3
Definition
(RefSeq) H2A clustered histone 18
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8337 (H2AC18)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8337 (H2AC18)
  09165 Substance dependence
   05034 Alcoholism
    8337 (H2AC18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8337 (H2AC18)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8337 (H2AC18)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8337 (H2AC18)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8337 (H2AC18)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 8337
NCBI-ProteinID: NP_003507
OMIM: 142720
HGNC: 4736
Ensembl: ENSG00000203812
Vega: OTTHUMG00000188678
Pharos: Q6FI13(Tdark)
UniProt: Q6FI13
LinkDB
Structure
PDB: 

Position
1q21.2
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggtcgtggcaagcaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc
cgcgctggccttcagttcccggtagggcgagtgcatcgcttgctgcgcaaaggcaactac
gcggagcgagtgggggccggcgcgcccgtctacatggctgcggtcctcgagtatctgacc
gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggcaaa
gtcaccatcgcccagggcggcgtcttgcctaacatccaggccgtactgctccctaagaag
acggagagtcaccacaaggcaaagggcaagtga

KEGG   Homo sapiens (human): 8338
Entry
8338              CDS       T01001                                 

Gene name
H2AC20, H2A, H2A-GL101, H2A/q, H2AFQ, HIST2H2AC
Definition
(RefSeq) H2A clustered histone 20
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8338 (H2AC20)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8338 (H2AC20)
  09165 Substance dependence
   05034 Alcoholism
    8338 (H2AC20)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8338 (H2AC20)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8338 (H2AC20)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8338 (H2AC20)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8338 (H2AC20)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 8338
NCBI-ProteinID: NP_003508
OMIM: 602797
HGNC: 4738
Ensembl: ENSG00000184260
Vega: OTTHUMG00000035825
Pharos: Q16777(Tbio)
UniProt: Q16777
LinkDB
Position
1q21.2
AA seq 129 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYMAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHKAKSK
NT seq 390 nt   +upstreamnt  +downstreamnt
atgtctggtcgtggcaaacaaggaggcaaggcccgcgccaaggccaagtcgcgctcgtcc
cgcgctggcctccagttcccggtagggcgagtgcaccgcttgctgcgcaaaggcaactac
gcggagcgggtgggggccggcgcgcccgtctacatggcggcggtcctcgagtacctgacc
gccgagatcctggagctggcgggcaacgcggctcgggacaacaagaagacgcgcatcatc
cctcgtcacctccagctggccatccgcaacgacgaggaactgaacaagctgctgggcaaa
gtcaccatcgcccagggcggcgttttgcctaacatccaggccgttctgttaccaaagaaa
accgaaagccacaaagccaaaagcaaataa

KEGG   Homo sapiens (human): 83740
Entry
83740             CDS       T01001                                 

Gene name
H2AB3, H2AB2, H2ABBD, H2AFB, H2AFB3
Definition
(RefSeq) H2A.B variant histone 3
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    83740 (H2AB3)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    83740 (H2AB3)
  09165 Substance dependence
   05034 Alcoholism
    83740 (H2AB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    83740 (H2AB3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    83740 (H2AB3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    83740 (H2AB3)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   83740 (H2AB3)
SSDB
Motif
Pfam: Histone
Other DBs
NCBI-GeneID: 83740
NCBI-ProteinID: NP_542451
OMIM: 300445
HGNC: 14455
Ensembl: ENSG00000277745
Vega: OTTHUMG00000022670
Pharos: P0C5Z0(Tdark)
UniProt: P0C5Z0
LinkDB
Position
Xq28
AA seq 115 aa
MPRRRRRRGSSGAGGRGRTCSRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVI
EYLTAKVLELAGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQVAPGED
NT seq 348 nt   +upstreamnt  +downstreamnt
atgccgaggaggaggagacgccgagggtcctccggtgctggcggccgggggcggacctgc
tctcgcaccgtccgagcggagctttcgttttcagtgagccaggtggagcgcagtctacgg
gagggccactacgctcagcgcctgagtcgcacggcgccggtctacctcgctgcggttatt
gagtacctgacggccaaggtcctggagctggcgggcaacgaggcccagaacagcggagag
cggaacatcactcccctgctgctggacatggtggttcacaacgacaggctactgagcacc
cttttcaacacgaccaccatctctcaagtggcccctggcgaggactag

KEGG   Homo sapiens (human): 85235
Entry
85235             CDS       T01001                                 

Gene name
H2AC12, H2A/S, H2AFALii, H2AH, HIST1H2AH, dJ86C11.1
Definition
(RefSeq) H2A clustered histone 12
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    85235 (H2AC12)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    85235 (H2AC12)
  09165 Substance dependence
   05034 Alcoholism
    85235 (H2AC12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    85235 (H2AC12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    85235 (H2AC12)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    85235 (H2AC12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   85235 (H2AC12)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 85235
NCBI-ProteinID: NP_542163
OMIM: 615013
HGNC: 13671
Ensembl: ENSG00000274997
Vega: OTTHUMG00000014468
Pharos: Q96KK5(Tdark)
UniProt: Q96KK5 A3KPC7
LinkDB
Position
6p22.1
AA seq 128 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtctggacgtggcaagcaaggcggtaaagctcgcgccaaggccaagacccgctcttct
cgggctgggcttcagttccccgtgggccgagtgcaccgcctgctccgcaagggtaattat
gccgagcgggttggagccggcgcgccagtgtacctggctgcggtgctggagtacctgacc
gctgagatcctggagctggctggcaatgcggcccgcgacaacaagaagacccgtatcatc
ccgcgtcacctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcgcagggtggtgtcttgcccaatatccaggccgtgctgctgcctaagaag
actgagagccaccataaggccaaataa

KEGG   Homo sapiens (human): 8969
Entry
8969              CDS       T01001                                 

Gene name
H2AC11, H2A.1b, H2A/p, H2AC13, H2AC15, H2AC16, H2AC17, H2AFP, H2AG, HIST1H2AG, pH2A/f
Definition
(RefSeq) H2A clustered histone 11
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8969 (H2AC11)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8969 (H2AC11)
  09165 Substance dependence
   05034 Alcoholism
    8969 (H2AC11)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8969 (H2AC11)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8969 (H2AC11)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8969 (H2AC11)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8969 (H2AC11)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8969
NCBI-ProteinID: NP_066408
OMIM: 615012
HGNC: 4737
Ensembl: ENSG00000196787
Vega: OTTHUMG00000014469
Pharos: P0C0S8(Tbio)
UniProt: P0C0S8 A4FTV9 B2R5B3
LinkDB
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtctggacgtggcaagcagggaggcaaagcccgcgctaaggccaagactcgctcttct
agggccggtctccagttccccgtgggccgagtgcaccgcctgctccgcaaaggcaactat
gccgagcgggtcggggccggcgcgccggtgtatctggcagcggtgctggagtacctgacc
gccgagatcctggaactggcgggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgtcatctccaactggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtcaccatcgcacagggcggtgtcctgcccaacattcaggccgtgctactgcccaaaaag
actgagagccaccacaaggcgaagggcaagtaa

KEGG   Homo sapiens (human): 92815
Entry
92815             CDS       T01001                                 

Gene name
H2AW, HIST3H2A
Definition
(RefSeq) H2A.W histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    92815 (H2AW)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    92815 (H2AW)
  09165 Substance dependence
   05034 Alcoholism
    92815 (H2AW)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    92815 (H2AW)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    92815 (H2AW)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    92815 (H2AW)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   92815 (H2AW)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 92815
NCBI-ProteinID: NP_254280
OMIM: 615015
HGNC: 20507
Ensembl: ENSG00000181218
Vega: OTTHUMG00000040046
Pharos: Q7L7L0(Tbio)
UniProt: Q7L7L0
LinkDB
Position
1q42.13
AA seq 130 aa
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtccggtcgtggtaagcagggtggcaaggcgcgcgccaaggctaagtcgcgctcgtcg
cgcgcggggctgcagttccccgtgggccgcgtgcaccggttgctccgcaagggcaactat
tcggagcgcgtgggcgccggcgccccggtctatctggccgcggtgctcgagtacttgact
gccgagatcctggagcttgccggcaacgcggcgcgcgacaacaagaagacgcgcatcatc
ccgcgccacctgcagctggccatccgcaacgacgaggagctcaacaagctgctgggccgc
gtgaccatcgcgcagggtggcgtcctgcccaacatccaggccgtactgctgcccaagaag
acggagagccaccacaaggccaagggcaagtga

KEGG   Homo sapiens (human): 94239
Entry
94239             CDS       T01001                                 

Gene name
H2AZ2, H2A.Z-2, H2AFV, H2AV
Definition
(RefSeq) H2A.Z variant histone 2
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    94239 (H2AZ2)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    94239 (H2AZ2)
  09165 Substance dependence
   05034 Alcoholism
    94239 (H2AZ2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    94239 (H2AZ2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    94239 (H2AZ2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    94239 (H2AZ2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   94239 (H2AZ2)
SSDB
Motif
Pfam: Histone Histone_H2A_C CBFD_NFYB_HMF
Other DBs
NCBI-GeneID: 94239
NCBI-ProteinID: NP_036544
HGNC: 20664
Ensembl: ENSG00000105968
Vega: OTTHUMG00000129217
Pharos: Q71UI9(Tdark)
UniProt: Q71UI9
LinkDB
Structure
PDB: 
3WAA

Position
7p13
AA seq 128 aa
MAGGKAGKDSGKAKAKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILE
YLTAEVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHIHKSLIG
KKGQQKTA
NT seq 387 nt   +upstreamnt  +downstreamnt
atggctggaggcaaagctggaaaggacagtgggaaggccaaggctaaggcagtatctcgc
tcacagagagctgggctacagtttcctgtgggccgcatccacagacacttgaagactcgc
accacaagccatggaagggtgggtgccactgctgccgtgtacagtgctgcgattctggag
tacctcactgcagaggtgctggagctggcaggtaatgcttctaaggatctcaaagtaaag
cgtatcactccgcgtcacttgcagcttgcaatccgtggtgatgaagagttggattctctt
atcaaggctaccatagctgggggtggtgtgatccctcacatccacaaatctctgattgga
aagaagggacagcagaaaactgcttag

KEGG   Homo sapiens (human): 9555
Entry
9555              CDS       T01001                                 

Gene name
MACROH2A1, H2A.y, H2A/y, H2AF12M, H2AFY, MACROH2A1.1, mH2A1, macroH2A1.2
Definition
(RefSeq) macroH2A.1 histone
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    9555 (MACROH2A1)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    9555 (MACROH2A1)
  09165 Substance dependence
   05034 Alcoholism
    9555 (MACROH2A1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    9555 (MACROH2A1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    9555 (MACROH2A1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    9555 (MACROH2A1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   9555 (MACROH2A1)
SSDB
Motif
Pfam: Macro Histone_H2A_C Histone CBFD_NFYB_HMF DUF1764 Clp_N
Other DBs
NCBI-GeneID: 9555
NCBI-ProteinID: NP_613258
OMIM: 610054
HGNC: 4740
Ensembl: ENSG00000113648
Vega: OTTHUMG00000129141
Pharos: O75367(Tbio)
UniProt: O75367
LinkDB
Structure
PDB: 

Position
5q31.1
AA seq 372 aa
MSSRGGKKKSTKTSRSAKAGVIFPVGRMLRYIKKGHPKYRIGVGAPVYMAAVLEYLTAEI
LELAGNAARDNKKGRVTPRHILLAVANDEELNQLLKGVTIASGGVLPNIHPELLAKKRGS
KGKLEAIITPPPAKKAKSPSQKKPVSKKAGGKKGARKSKKKQGEVSKAASADSTTEGTPA
DGFTVLSTKSLFLGQKLNLIHSEISNLAGFEVEAIINPTNADIDLKDDLGNTLEKKGGKE
FVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLAL
ADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIG
IYVQEMAKLDAN
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgtcgagccgcggtgggaagaagaagtccaccaagacgtccaggtctgccaaagcagga
gtcatctttcccgtggggcggatgctgcggtacatcaagaaaggccaccccaagtacagg
attggagtgggggcacccgtgtacatggccgccgtcctggaatacctgacagcggagatt
ctggagctggctggcaatgcagcgagagacaacaagaagggacgggtcacaccccggcac
atcctgctggctgtggccaatgatgaagagctgaatcagctgctaaaaggagtcaccata
gccagtgggggtgtgttacccaacatccaccccgagttgctagcgaagaagcggggatcc
aaaggaaagttggaagccatcatcacaccacccccagccaaaaaggccaagtctccatcc
cagaagaagcctgtatctaaaaaagcaggaggcaagaaaggggcccggaaatccaagaag
aagcagggtgaagtcagtaaggcagccagcgccgacagcacaaccgagggcacacctgcc
gacggcttcacagtcctctccaccaagagcctcttccttggccagaagctgaaccttatt
cacagtgaaatcagtaatttagccggctttgaggtggaggccataatcaatcctaccaat
gctgacattgaccttaaagatgacctaggaaacacgctggagaagaaaggtggcaaggag
tttgtggaagctgtcctggaactccggaaaaagaacgggcccttggaagtagctggagct
gctgtcagcgcaggccatggcctgcctgccaagtttgtgatccactgtaatagtccagtt
tggggtgcagacaagtgtgaagaacttctggaaaagacagtgaaaaactgcttggccctg
gctgatgataagaagctgaaatccattgcatttccatccatcggcagcggcaggaacggt
tttccaaagcagacagcagctcagctgattctgaaggccatctccagttacttcgtgtct
acaatgtcctcttccatcaaaacggtgtacttcgtgctttttgacagcgagagtataggc
atctatgtgcaggaaatggccaagctggacgccaactag

DBGET integrated database retrieval system