KEGG   Homo sapiens (human): 221895
Entry
221895            CDS       T01001                                 

Gene name
JAZF1, TIP27, ZNF802
Definition
(RefSeq) JAZF zinc finger 1
  KO
K19495  juxtaposed with another zinc finger protein 1
Organism
hsa  Homo sapiens (human)
Disease
H00409  Type 2 diabetes mellitus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    221895 (JAZF1)
SSDB
Motif
Pfam: zf-C2H2_aberr zf-C2H2 FOXP-CC zf-C2H2_4 zf-C2H2_6
Other DBs
NCBI-GeneID: 221895
NCBI-ProteinID: NP_778231
OMIM: 606246
HGNC: 28917
Ensembl: ENSG00000153814
Vega: OTTHUMG00000128545
Pharos: Q86VZ6(Tbio)
UniProt: Q86VZ6
LinkDB
Position
7p15.2-p15.1
AA seq 243 aa
MTGIAAASFFSNTCRFGGCGLHFPTLADLIEHIEDNHIDTDPRVLEKQELQQPTYVALSY
INRFMTDAARREQESLKKKIQPKLSLTLSSSVSRGNVSTPPRHSSGSLTPPVTPPITPSS
SFRSSTPTGSEYDEEEVDYEESDSDESWTTESAISSEAILSSMCMNGGEEKPFACPVPGC
KKRYKNVNGIKYHAKNGHRTQIRVRKPFKCRCGKSYKTAQGLRHHTINFHPPVSAEIIRK
MQQ
NT seq 732 nt   +upstreamnt  +downstreamnt
atgacaggcatcgccgccgcctccttcttctccaatacctgccgattcgggggctgcgga
ctccacttccccaccctggccgacctcatcgagcacatcgaggacaaccacatcgataca
gatccacgggttttagaaaaacaagaattacagcagccaacctatgttgccctgagttac
ataaatagattcatgacagatgctgcccgccgagagcaggagtccctaaagaagaagatt
cagccgaagctctcgctgactctgtccagctcagtgtctcgagggaatgtgtccactccc
ccacgccacagcagtggaagccttactccccccgtgaccccacccatcaccccctcctct
tcattccgcagcagcactccgacaggcagcgagtatgacgaggaggaggtggactatgag
gagtcggacagcgatgagtcctggaccacagagagtgccatcagctccgaagccatcctc
agctccatgtgcatgaatggaggggaagagaagccttttgcctgcccagttcctggatgt
aaaaagagatacaagaatgtgaatggcataaagtatcacgctaagaatggtcacagaaca
cagattcgtgtccgcaaaccattcaagtgtcgctgtgggaagagttacaagacagctcag
ggcctgcggcaccacacaatcaatttccatcccccggtgtcggctgagattatcaggaag
atgcagcaataa

DBGET integrated database retrieval system