KEGG   Homo sapiens (human): 222236
Entry
222236            CDS       T01001                                 

Gene name
NAPEPLD, C7orf18, FMP30, NAPE-PLD
Definition
(RefSeq) N-acyl phosphatidylethanolamine phospholipase D
  KO
K13985  N-acyl-phosphatidylethanolamine-hydrolysing phospholipase D [EC:3.1.4.54]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04723  Retrograde endocannabinoid signaling
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    222236 (NAPEPLD)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.54  N-acetylphosphatidylethanolamine-hydrolysing phospholipase D
     222236 (NAPEPLD)
SSDB
Motif
Pfam: Lactamase_B_2 Lactamase_B_3 Lactamase_B
Other DBs
NCBI-GeneID: 222236
NCBI-ProteinID: NP_001116310
OMIM: 612334
HGNC: 21683
Ensembl: ENSG00000161048
Vega: OTTHUMG00000157204
Pharos: Q6IQ20(Tbio)
UniProt: Q6IQ20
LinkDB
Structure
PDB: 
4QN9

Position
7q22.1
AA seq 393 aa
MDENESNQSLMTSSQYPKEAVRKRQNSARNSGASDSSRFSRKSFKLDYRLEEDVTKSKKG
KDGRFVNPWPTWKNPSIPNVLRWLIMEKDHSSVPSSKEELDKELPVLKPYFITNPEEAGV
REAGLRVTWLGHATVMVEMDELIFLTDPIFSSRASPSQYMGPKRFRRSPCTISELPPIDA
VLISHNHYDHLDYNSVIALNERFGNELRWFVPLGLLDWMQKCGCENVIELDWWEENCVPG
HDKVTFVFTPSQHWCKRTLMDDNKVLWGSWSVLGPWNRFFFAGDTGYCPAFEEIGKRFGP
FDLAAIPIGAYEPRWFMKYQHVDPEEAVRIHTDVQTKKSMAIHWGTFALANEHYLEPPVK
LNEALERYGLNAEDFFVLKHGESRYLNNDDENF
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggatgaaaatgaaagcaaccagtctctgatgacaagcagccaatatcctaaagaagca
gtaagaaaacgtcaaaattcagcacggaattccggagcaagtgattcttctaggttttct
aggaaaagcttcaaactggattatagactagaagaagatgtaactaaatccaagaaagga
aaagatgggagatttgtgaatccgtggccaacatggaaaaacccctctattccaaatgtt
ctcagatggctgataatggagaaagatcacagcagtgttccaagttctaaagaggaacta
gacaaagaactcccagtgcttaagccatattttatcactaaccctgaagaagctggagtg
agggaagctggcttaagagtcacatggctgggacatgccacggtaatggtggaaatggat
gagctcatatttctcacggatcccatctttagctctcgtgcttcaccatcgcagtacatg
ggtccaaagcgatttcgtcgttccccgtgcacaataagtgaactccctccaatagatgcg
gtccttatcagtcacaaccactatgaccatctggactacaattctgtcattgctttgaat
gagcgatttggtaatgagttgagatggtttgtgcctttgggtctccttgactggatgcaa
aaatgtggctgtgagaatgtgattgagttggactggtgggaggagaattgtgtccccgga
catgataaggtcacttttgtctttacaccttcccagcactggtgtaaaaggactctaatg
gatgacaacaaggtgctatggggcagctggtctgtcttggggccttggaatcgatttttt
ttcgcaggagatactggttattgccctgcttttgaagagataggaaaaagatttggacct
tttgaccttgcagctattcccatcggagcttatgaaccgaggtggtttatgaaataccag
catgtagacccagaagaagctgtaaggattcacactgatgtccaaacaaagaaatctatg
gcaattcactggggaacttttgccttagcaaatgagcattacttagagcctccagtgaag
ctgaatgaagctctagagagatacggacttaacgctgaagatttttttgtcttgaagcat
ggagaatcaagatacctaaataatgatgatgaaaacttttaa

DBGET integrated database retrieval system