KEGG   Homo sapiens (human): 2239Help
Entry
2239              CDS       T01001                                 

Gene name
GPC4, K-glypican, KPTS
Definition
(RefSeq) glypican 4
  KO
K08110  glypican 4
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
Disease
H02326  Keipert syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    2239 (GPC4)
Proteoglycans [BR:hsa00535]
 Cell surface proteoglycans
  Glypican family (GPI-anchored HSPG)
   2239 (GPC4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Others
  2239 (GPC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glypican DUF1910 Corona_6B_7B
Motif
Other DBs
NCBI-GeneID: 2239
NCBI-ProteinID: NP_001439
OMIM: 300168
HGNC: 4452
Ensembl: ENSG00000076716
Vega: OTTHUMG00000022434
Pharos: O75487(Tbio)
UniProt: O75487
LinkDB All DBs
Position
Xq26.2
AA seq 556 aa AA seqDB search
MARFGLPALLCTLAVLSAALLAAELKSKSCSEVRRLYVSKGFNKNDAPLHEINGDHLKIC
PQGSTCCSQEMEEKYSLQSKDDFKSVVSEQCNHLQAVFASRYKKFDEFFKELLENAEKSL
NDMFVKTYGHLYMQNSELFKDLFVELKRYYVVGNVNLEEMLNDFWARLLERMFRLVNSQY
HFTDEYLECVSKYTEQLKPFGDVPRKLKLQVTRAFVAARTFAQGLAVAGDVVSKVSVVNP
TAQCTHALLKMIYCSHCRGLVTVKPCYNYCSNIMRGCLANQGDLDFEWNNFIDAMLMVAE
RLEGPFNIESVMDPIDVKISDAIMNMQDNSVQVSQKVFQGCGPPKPLPAGRISRSISESA
FSARFRPHHPEERPTTAAGTSLDRLVTDVKEKLKQAKKFWSSLPSNVCNDERMAAGNGNE
DDCWNGKGKSRYLFAVTGNGLANQGNNPEVQVDTSKPDILILRQIMALRVMTSKMKNAYN
GNDVDFFDISDESSGEGSGSGCEYQQCPSEFDYNATDHAGKSANEKADSAGVRPGAQAYL
LTVFCILFLVMQREWR
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggcacggttcggcttgcccgcgcttctctgcaccctggcagtgctcagcgccgcgctg
ctggctgccgagctcaagtcgaaaagttgctcggaagtgcgacgtctttacgtgtccaaa
ggcttcaacaagaacgatgcccccctccacgagatcaacggtgatcatttgaagatctgt
ccccagggttctacctgctgctctcaagagatggaggagaagtacagcctgcaaagtaaa
gatgatttcaaaagtgtggtcagcgaacagtgcaatcatttgcaagctgtctttgcttca
cgttacaagaagtttgatgaattcttcaaagaactacttgaaaatgcagagaaatccctg
aatgatatgtttgtgaagacatatggccatttatacatgcaaaattctgagctatttaaa
gatctcttcgtagagttgaaacgttactacgtggtgggaaatgtgaacctggaagaaatg
ctaaatgacttctgggctcgcctcctggagcggatgttccgcctggtgaactcccagtac
cactttacagatgagtatctggaatgtgtgagcaagtatacggagcagctgaagcccttc
ggagatgtccctcgcaaattgaagctccaggttactcgtgcttttgtagcagcccgtact
ttcgctcaaggcttagcggttgcgggagatgtcgtgagcaaggtctccgtggtaaacccc
acagcccagtgtacccatgccctgttgaagatgatctactgctcccactgccggggtctc
gtgactgtgaagccatgttacaactactgctcaaacatcatgagaggctgtttggccaac
caaggggatctcgattttgaatggaacaatttcatagatgctatgctgatggtggcagag
aggctagagggtcctttcaacattgaatcggtcatggatcccatcgatgtgaagatttct
gatgctattatgaacatgcaggataatagtgttcaagtgtctcagaaggttttccaggga
tgtggaccccccaagcccctcccagctggacgaatttctcgttccatctctgaaagtgcc
ttcagtgctcgcttcagaccacatcaccccgaggaacgcccaaccacagcagctggcact
agtttggaccgactggttactgatgtcaaggagaaactgaaacaggccaagaaattctgg
tcctcccttccgagcaacgtttgcaacgatgagaggatggctgcaggaaacggcaatgag
gatgactgttggaatgggaaaggcaaaagcaggtacctgtttgcagtgacaggaaatgga
ttagccaaccagggcaacaacccagaggtccaggttgacaccagcaaaccagacatactg
atccttcgtcaaatcatggctcttcgagtgatgaccagcaagatgaagaatgcatacaat
gggaacgacgtggacttctttgatatcagtgatgaaagtagtggagaaggaagtggaagt
ggctgtgagtatcagcagtgcccttcagagtttgactacaatgccactgaccatgctggg
aagagtgccaatgagaaagccgacagtgctggtgtccgtcctggggcacaggcctacctc
ctcactgtcttctgcatcttgttcctggttatgcagagagagtggagataa

DBGET integrated database retrieval system