KEGG   Homo sapiens (human): 2242Help
Entry
2242              CDS       T01001                                 

Gene name
FES, FPS
Definition
(RefSeq) FES proto-oncogene, tyrosine kinase
  KO
K07527  tyrosine-protein kinase Fes/Fps [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    2242 (FES)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2242 (FES)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2242 (FES)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2242 (FES)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  FES family
   2242 (FES)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    2242 (FES)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 FCH Muted
Motif
Other DBs
NCBI-GeneID: 2242
NCBI-ProteinID: NP_001996
OMIM: 190030
HGNC: 3657
Ensembl: ENSG00000182511
Vega: OTTHUMG00000044456
Pharos: P07332(Tchem)
UniProt: P07332 A0A024RC92
LinkDB All DBs
Structure
PDB: 

Position
15q26.1
AA seq 822 aa AA seqDB search
MGFSSELCSPQGHGVLQQMQEAELRLLEGMRKWMAQRVKSDREYAGLLHHMSLQDSGGQS
RAISPDSPISQSWAEITSQTEGLSRLLRQHAEDLNSGPLSKLSLLIRERQQLRKTYSEQW
QQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLF
AHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDE
VVAIHREMAAAAARIQPEAEYQGFLRQYGSAPDVPPCVTFDESLLEEGEPLEPGELQLNE
LTVESVQHTLTSVTDELAVATEMVFRRQEMVTQLQQELRNEEENTHPRERVQLLGKRQVL
QEALQGLQVALCSQAKLQAQQELLQTKLEHLGPGEPPPVLLLQDDRHSTSSSEQEREGGR
TPTLEILKSHISGIFRPKFSLPPPLQLIPEVQKPLHEQLWYHGAIPRAEVAELLVHSGDF
LVRESQGKQEYVLSVLWDGLPRHFIIQSLDNLYRLEGEGFPSIPLLIDHLLSTQQPLTKK
SGVVLHRAVPKDKWVLNHEDLVLGEQIGRGNFGEVFSGRLRADNTLVAVKSCRETLPPDL
KAKFLQEARILKQYSHPNIVRLIGVCTQKQPIYIVMELVQGGDFLTFLRTEGARLRVKTL
LQMVGDAAAGMEYLESKCCIHRDLAARNCLVTEKNVLKISDFGMSREEADGVYAASGGLR
QVPVKWTAPEALNYGRYSSESDVWSFGILLWETFSLGASPYPNLSNQQTREFVEKGGRLP
CPELCPDAVFRLMEQCWAYEPGQRPSFSTIYQELQSIRKRHR
NT seq 2469 nt NT seq  +upstreamnt  +downstreamnt
atgggcttctcttccgagctgtgcagcccccagggccacggggtcctgcagcaaatgcag
gaggccgagcttcgtctactggagggcatgagaaagtggatggcccagcgggtcaagagt
gacagggagtatgcaggactgcttcaccacatgtccctgcaggacagtgggggccagagc
cgggccatcagccctgacagccccatcagtcagtcctgggctgagatcaccagccaaact
gagggcctgagccgcttgctgcggcagcacgcagaggatctgaactcagggcccctgagc
aagctgagcctgctcatccgggaacggcagcagcttcgcaagacctacagcgagcagtgg
cagcagctgcagcaggagctcaccaagacccacagccaggacattgagaagctgaagagc
cagtaccgagctctggcacgggacagtgcccaagccaagcgcaagtaccaggaggccagc
aaagacaaggaccgtgacaaggctaaggacaagtatgtgcgcagcctgtggaagctcttt
gctcaccacaaccgctatgtgctgggcgtgcgggctgcgcagctacaccaccagcaccac
caccagctcctgctgcccggcctgctgcggtcactgcaggacctgcacgaggagatggct
tgcatcctgaaggagatcctgcaggaatacctggagattagcagcctggtgcaggatgag
gtggtggccattcaccgggagatggctgcagctgctgcccgcatccagcctgaggctgag
taccaaggcttcctgcgacagtatgggtccgcacctgacgtcccaccctgtgtcacgttc
gatgagtcactgcttgaggagggtgaaccgctggagcctggggagctccagctgaacgag
ctgactgtggagagcgtgcagcacacgctgacctcagtgacagatgagctggctgtggcc
accgagatggtgttcaggcggcaggagatggttacgcagctgcaacaggagctccggaat
gaagaggagaacacccacccccgggagcgggtgcagctgctgggcaagaggcaagtgctg
caagaagcactgcaggggctgcaggtagcgctgtgcagccaggccaagctgcaggcccag
caggagttgctgcagaccaagctggagcacctgggccccggcgagcccccgcctgtgctg
ctcctgcaggatgaccgccactccacgtcgtcctcggagcaggagcgagaggggggaagg
acacccacgctggagatccttaagagccacatctcaggaatcttccgccccaagttctcg
ctccctccaccgctgcagctcattccggaggtgcagaagcccctgcatgagcagctgtgg
taccacggggccatcccgagggcagaggtggctgagctgctggtgcactctggggacttc
ctggtgcgggagagccagggcaagcaggagtacgtgctgtcggtgctgtgggatggtctg
ccccggcacttcatcatccagtccttggataacctgtaccgactggaaggggaaggcttt
cctagcattcctttgctcatcgaccacctactgagcacccagcagcccctcaccaagaag
agtggtgttgtcctgcacagggctgtgcccaaggacaagtgggtgctgaaccatgaggac
ctggtgttgggtgagcagattggacgggggaactttggcgaagtgttcagcggacgcctg
cgagccgacaacaccctggtggcggtgaagtcttgtcgagagacgctcccacctgacctc
aaggccaagtttctacaggaagcgaggatcctgaagcagtacagccaccccaacatcgtg
cgtctcattggtgtctgcacccagaagcagcccatctacatcgtcatggagcttgtgcag
gggggcgacttcctgaccttcctccgcacggagggggcccgcctgcgggtgaagactctg
ctgcagatggtgggggatgcagctgctggcatggagtacctggagagcaagtgctgcatc
caccgggacctggctgctcggaactgcctggtgacagagaagaatgtcctgaagatcagt
gactttgggatgtcccgagaggaagccgatggggtctatgcagcctcagggggcctcaga
caagtccccgtgaagtggaccgcacctgaggcccttaactacggccgctactcctccgaa
agcgacgtgtggagctttggcatcttgctctgggagaccttcagcctgggggcctccccc
tatcccaacctcagcaatcagcagacacgggagtttgtggagaaggggggccgtctgccc
tgcccagagctgtgtcctgatgccgtgttcaggctcatggagcagtgctgggcctatgag
cctgggcagcggcccagcttcagcaccatctaccaggagctgcagagcatccgaaagcgg
catcggtga

DBGET integrated database retrieval system