KEGG   Homo sapiens (human): 2251Help
Entry
2251              CDS       T01001                                 

Gene name
FGF6, HBGF-6, HST2
Definition
(RefSeq) fibroblast growth factor 6
  KO
K04358  fibroblast growth factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05218  Melanoma
hsa05224  Breast cancer
hsa05226  Gastric cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06261  Gastric cancer
nt06265  Bladder cancer
nt06270  Breast cancer
  Element
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2251 (FGF6)
   04015 Rap1 signaling pathway
    2251 (FGF6)
   04010 MAPK signaling pathway
    2251 (FGF6)
   04151 PI3K-Akt signaling pathway
    2251 (FGF6)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    2251 (FGF6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2251 (FGF6)
  09162 Cancer: specific types
   05226 Gastric cancer
    2251 (FGF6)
   05218 Melanoma
    2251 (FGF6)
   05224 Breast cancer
    2251 (FGF6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2251 (FGF6)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    2251 (FGF6)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2251 (FGF6)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   2251 (FGF6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FGF
Motif
Other DBs
NCBI-GeneID: 2251
NCBI-ProteinID: NP_066276
OMIM: 134921
HGNC: 3684
Ensembl: ENSG00000111241
Vega: OTTHUMG00000168242
Pharos: P10767(Tbio)
UniProt: P10767
LinkDB All DBs
Position
12p13.32
AA seq 208 aa AA seqDB search
MALGQKLFITMSRGAGRLQGTLWALVFLGILVGMVVPSPAGTRANNTLLDSRGWGTLLSR
SRAGLAGEIAGVNWESGYLVGIKRQRRLYCNVGIGFHLQVLPDGRISGTHEENPYSLLEI
STVERGVVSLFGVRSALFVAMNSKGRLYATPSFQEECKFRETLLPNNYNAYESDLYQGTY
IALSKYGRVKRGSKVSPIMTVTHFLPRI
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggccctgggacagaaactgttcatcactatgtcccggggagcaggacgtctgcagggc
acgctgtgggctctcgtcttcctaggcatcctagtgggcatggtggtgccctcgcctgca
ggcacccgtgccaacaacacgctgctggactcgaggggctggggcaccctgctgtccagg
tctcgcgccgggctagctggagagattgccggggtgaactgggaaagtggctatttggtg
gggatcaagcggcagcggaggctctactgcaacgtgggcatcggctttcacctccaggtg
ctccccgacggccggatcagcgggacccacgaggagaacccctacagcctgctggaaatt
tccactgtggagcgaggcgtggtgagtctctttggagtgagaagtgccctcttcgttgcc
atgaacagtaaaggaagattgtacgcaacgcccagcttccaagaagaatgcaagttcaga
gaaaccctcctgcccaacaattacaatgcctacgagtcagacttgtaccaagggacctac
attgccctgagcaaatacggacgggtaaagcggggcagcaaggtgtccccgatcatgact
gtcactcatttccttcccaggatctaa

DBGET integrated database retrieval system