KEGG   Homo sapiens (human): 226Help
Entry
226               CDS       T01001                                 

Gene name
ALDOA, ALDA, GSD12, HEL-S-87p
Definition
(RefSeq) aldolase, fructose-bisphosphate A
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
N00739  ALDOA deficiency in glycolysis
Disease
H00069  Glycogen storage disease
H01762  Muscle glycogen storage disease
H01952  Glycogen storage disease type XII
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    226 (ALDOA)
   00030 Pentose phosphate pathway
    226 (ALDOA)
   00051 Fructose and mannose metabolism
    226 (ALDOA)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    226 (ALDOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    226 (ALDOA)
   03036 Chromosome and associated proteins [BR:hsa03036]
    226 (ALDOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    226 (ALDOA)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     226 (ALDOA)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    226 (ALDOA)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    226 (ALDOA)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   226 (ALDOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 226
NCBI-ProteinID: NP_001121089
OMIM: 103850
HGNC: 414
Ensembl: ENSG00000149925 ENSG00000285043
Vega: OTTHUMG00000132107
Pharos: P04075(Tbio)
UniProt: P04075 V9HWN7
LinkDB All DBs
Structure
PDB: 

Position
16p11.2
AA seq 364 aa AA seqDB search
MPYQYPALTPEQKKELSDIAHRIVAPGKGILAADESTGSIAKRLQSIGTENTEENRRFYR
QLLLTADDRVNPCIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTN
GETTTQGLDGLSERCAQYKKDGADFAKWRCVLKIGEHTPSALAIMENANVLARYASICQQ
NGIVPIVEPEILPDGDHDLKRCQYVTEKVLAAVYKALSDHHIYLEGTLLKPNMVTPGHAC
TQKFSHEEIAMATVTALRRTVPPAVTGITFLSGGQSEEEASINLNAINKCPLLKPWALTF
SYGRALQASALKAWGGKKENLKAAQEEYVKRALANSLACQGKYTPSGQAGAAASESLFVS
NHAY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgccctaccaatatccagcactgaccccggagcagaagaaggagctgtctgacatcgct
caccgcatcgtggcacctggcaagggcatcctggctgcagatgagtccactgggagcatt
gccaagcggctgcagtccattggcaccgagaacaccgaggagaaccggcgcttctaccgc
cagctgctgctgacagctgacgaccgcgtgaacccctgcattgggggtgtcatcctcttc
catgagacactctaccagaaggcggatgatgggcgtcccttcccccaagttatcaaatcc
aagggcggtgttgtgggcatcaaggtagacaagggcgtggtccccctggcagggacaaat
ggcgagactaccacccaagggttggatgggctgtctgagcgctgtgcccagtacaagaag
gacggagctgacttcgccaagtggcgttgtgtgctgaagattggggaacacaccccctca
gccctcgccatcatggaaaatgccaatgttctggcccgttatgccagtatctgccagcag
aatggcattgtgcccatcgtggagcctgagatcctccctgatggggaccatgacttgaag
cgctgccagtatgtgaccgagaaggtgctggctgctgtctacaaggctctgagtgaccac
cacatctacctggaaggcaccttgctgaagcccaacatggtcaccccaggccatgcttgc
actcagaagttttctcatgaggagattgccatggcgaccgtcacagcgctgcgccgcaca
gtgccccccgctgtcactgggatcaccttcctgtctggaggccagagtgaggaggaggcg
tccatcaacctcaatgccattaacaagtgccccctgctgaagccctgggccctgaccttc
tcctacggccgagccctgcaggcctctgccctgaaggcctggggcgggaagaaggagaac
ctgaaggctgcgcaggaggagtatgtcaagcgagccctggccaacagccttgcctgtcaa
ggaaagtacactccgagcggtcaggctggggctgctgccagcgagtccctcttcgtctct
aaccacgcctattaa

DBGET integrated database retrieval system